SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016108 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016108
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.33e-35
Family Calponin-homology domain, CH-domain 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016108   Gene: ENSGMOG00000015051   Transcript: ENSGMOT00000016519
Sequence length 297
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1590:41549:51668:1 gene:ENSGMOG00000015051 transcript:ENSGMOT00000016519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQHFRSGPSFGLSAEVKSKLAGKYDLQKEEELRRWIQDVIGKRVPDPFMESLKDGVILC
XXXXXXXXXXVRKINNSTQNWHQLENIGNFVRAITKYGLKLHDLFEANDLFENTNHTQVQ
STLITLAGVAQSKGFHTKNDMGVKYIEATHRRFAPEKLKEGRNIIGLQMGTNKLASQKGM
TSYGARRLLFDSKIGMDNPLDQSTISLQMGTNKGANQAGMTAPGTRRLIFDKKLDLETCD
SSTVSLQMGTNKRASQRGMTSYGQPRQVCDNKYCTNPTEQDPYNGQGDYDAYNQYSE
Download sequence
Identical sequences ENSGMOP00000016108 ENSGMOP00000016108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]