SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016234 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016234
Domain Number 1 Region: 231-378
Classification Level Classification E-value
Superfamily EF-hand 1.29e-39
Family Calmodulin-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016234   Gene: ENSGMOG00000015162   Transcript: ENSGMOT00000016649
Sequence length 380
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2085:91935:97413:1 gene:ENSGMOG00000015162 transcript:ENSGMOT00000016649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSFPKSESRTSLLKSSTRGPSSHLDRAPESHRSHHHHHNHHRPAALASGHPADESFWS
AQCDVRPPYHHSAPGNRDPAPPRDGNRYHSPKHHHRVSSAPSQEEPSGEKERLVRESCKA
SRSTHRHHRRRPDRDEPPHAPQGYTHSVRTVPRIPSLSETDDTAPFFKRTDRQEPGRAGG
PDEGRAPSPSSLSPPSSSQSCRRSRRSSTTSSTIGLNLRTVLNSLFGQDRELRPEELDEL
RDAFKEFDKDKDGFISCKDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFEDFVELM
GPKLLAETADMIGIKELKEAFREFDTNGDGAISLSELREAMKKLLGQQVCPKDLEDILRD
VDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences ENSGMOP00000016234 ENSGMOP00000016234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]