SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016265 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016265
Domain Number 1 Region: 248-525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-86
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000016
Further Details:      
 
Domain Number 2 Region: 107-226
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-30
Family SH2 domain 0.00000944
Further Details:      
 
Domain Number 3 Region: 2-106
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-28
Family SH2 domain 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016265   Gene: ENSGMOG00000015181   Transcript: ENSGMOT00000016680
Sequence length 595
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1082:18317:48517:-1 gene:ENSGMOG00000015181 transcript:ENSGMOT00000016680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSRWFHPNITGIEAEQMLLTRGVHGSFLARPSKSNPGDFTLSVRRDDEVTHIKIQNSGD
YYDLYGGEKFATLAELVQYYTEQQDLLRERNGHVIQLKYPLNCKDPTTERWYHGHLSGRD
AEKLLLEKGRVGSFLVRESQSKPGDFVLSVLTNEEKQENLDRRTKVTHVMIRFQQDGKYD
VGGGERFDTLADLVDHYKKNPMVEKSGIVVHLKQPFNATRIIASNIENRVRELNKVADNS
EKPKQGFWEEFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTTRVELREVDPEVA
GSDYINANYIRSFREEGRSGEEGKVFIATQGCLQITVVDFWKMVYQENTHVIVMTTKEME
RGRNKCVRYWPSEPGSSKEFGNILVRNVKERPAQDYILRRLEVTRLDRREQVRYIWHFQY
LSWPDHGVPTEPGGVLSFLEQVNHTQTTIPDTGPIVVHCSAGIGRTGTIIVIDILIDVIN
RQGLDCDIDIPKSIQRVRQQRSGMVQTEAQYKFIYMAVQQYIDTAQKRLEQEQKNKTLES
EYSNIQYPPMTNSRSKISMNASRSSSVLTNDDSSSIYENISIKSPKAASSGPARR
Download sequence
Identical sequences ENSGMOP00000016265 ENSGMOP00000016265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]