SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016291 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016291
Domain Number 1 Region: 98-314,421-526
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.22e-87
Family Protein serine/threonine phosphatase 0.00000202
Further Details:      
 
Domain Number 2 Region: 603-706
Classification Level Classification E-value
Superfamily EF-hand 8.75e-17
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016291   Gene: ENSGMOG00000015201   Transcript: ENSGMOT00000016706
Sequence length 710
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2764:154:24774:1 gene:ENSGMOG00000015201 transcript:ENSGMOT00000016706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGVSKSNLFQXXXXXXIKAAVLIQHWYRQYVARMELKRRYTWHIFQSLEYSGEQAQIK
LYNFLGYLMDNFTPSSNERNLISHFFRENEVCRDSEWERFFDYKNIDVPEIYSGPHLTFP
LTLEQGSGLVDAFRNKRQQLHSRYVLQLLLDTWRLLRKFPNISRVSTCQSKEITICGDLH
GQLEDLLLIFYKNGMPSHERPYVFNGDFVDRGDNSIEVLLILFSFLLLYPNDVHLNRGNH
EDHIVNLRYGFTKEVLTKYKMHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDL
SVLARVDRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXILDLLWSDPMTQDGCVPNEVRGGGCYWGPDVTDDFLSRHNMTLIIRSHECKQEGYEF
CHNRKVLTLFSASNYYDVASNRGAYVKLGPDLVPYLIQYQASSKTRELTVRQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVSLKDWAEAVEGVMHLGLPWRMLRSQLISR
RASDGAVDYRQWFTELAIQEPNMEHIEKGLLEMLYRHRSTLETIFRIVDTDNSGVINMED
FRQTWKLLSIYLKMEFTEEAISDLAVAIDTNGDGCIDIQEFMEAFRLSDK
Download sequence
Identical sequences ENSGMOP00000016291 ENSGMOP00000016291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]