SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016299 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016299
Domain Number 1 Region: 2-120,149-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-74
Family Calponin-homology domain, CH-domain 0.0000368
Further Details:      
 
Domain Number 2 Region: 6921-7056
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 7898-8037
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-16
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 4 Region: 7768-7894
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 7360-7492
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-16
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 2621-2742
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-16
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 7 Region: 3277-3399
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-16
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 8 Region: 7028-7164
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000196
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 3007-3119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000324
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 8350-8465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000981
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 11 Region: 3505-3637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000173
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 12 Region: 4232-4388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000734
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 13 Region: 4998-5114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000134
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 14 Region: 521-658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000319
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 3751-3867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000528
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 16 Region: 1979-2135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000576
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 5689-5767,5858-5904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000682
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 18 Region: 4343-4498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000095
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 1381-1492
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000104
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 20 Region: 4469-4609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000013
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 21 Region: 5858-6007
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000224
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 22 Region: 7680-7780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000555
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 23 Region: 3112-3225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000628
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 1580-1697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000273
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 25 Region: 7599-7716
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000327
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 26 Region: 5477-5588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000353
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 3428-3537
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000667
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 28 Region: 6849-6958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000777
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 29 Region: 6013-6136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000101
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 30 Region: 7234-7354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000212
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 31 Region: 7452-7589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 2755-2823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000118
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 6491-6574
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000222
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 34 Region: 920-954,1053-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000234
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 1665-1798
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000272
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 36 Region: 8421-8561
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000048
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016299
Domain Number - Region: 5559-5652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 6618-6734
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000317
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number - Region: 1481-1595
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000352
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 4134-4277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number - Region: 8085-8144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 4022-4146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00863
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 5246-5374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0131
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 4790-4875
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0133
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 3855-3908
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0272
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2223-2310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0302
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 6315-6420
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0304
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 664-763
Classification Level Classification E-value
Superfamily Spectrin repeat 0.04
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 6420-6521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number - Region: 2548-2610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0762
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016299   Gene: ENSGMOG00000014932   Transcript: ENSGMOT00000016714
Sequence length 8670
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1677:37650:250329:-1 gene:ENSGMOG00000014932 transcript:ENSGMOT00000016714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEQEAVQKRTFTKWINSHLAKCQPPLVVTDLFEDIKDGVILLALLEVLSGQSLPCEQGKK
LRRIHWVANIGTALNFLEGRKXKLVNINSTDIVDGRPSIVLGLVWTIILYFQIEELTSSL
PALSGSSSSMDSSNSSTDTTSPPVKRKLLPPAQGGARKALLRWVQHTAHLGIEVKDFGPS
WRTGMAFFAVIHALRPSLVDLDRIQRRPNRDNLREAFSLAETKLGIPQLLDPEDVDVDKP
DEKSIMTYVAQFLKHHPDRMQSESDSQTEEERERRKGLREMKMWLDQLDRDVTQARDTET
NLTQRYQSFKRLRVQLEVRSRQVEAALQSSQKDGMLTVDQALVKQTWGRVSNRLLDWHLQ
LDRSLPAPLGQVGVWLHRAEEALRQDIPPAPQAHEQTTGTVHRALEQHKEVLRSLEIHQQ
SFQKIHQDRCVEGVPVPPEQLQDLAERINFVSTSSNVHLAKMEFVENQHQIQAFLILAES
KLKSWIIKYGHRESVEKMLLNYVTFVEKQHLFENYEALFQSLKRSAEQYVAVDASVEEGE
CGVRRFLREVVGQWRSLSVEVRSVRSMLEEVLSNWERYGSTVASLQAWLEDAEAALSQPE
NTKREFFRNLQLMMEQHAAMNDAGNFLIETCDESVSLGLKQQLLLLNGRWRDLFLHVKHY
AHAEELEAWRRDHLKAMSALRELLDSAEGKLNAPVPLAFSPVRSFLQDVENTKQKIVSME
TQFKLVSRSAQLLAKDAPPDEGARVMAAMATAKGQLSKVRERCPPLVRECHGLLPLLEEM
EKHTAAFHLSLERAGLLXXXXXXXXXXXXLSVIERNFHALQRALSTSKVLHNVDQTLLKK
RTAEIQASAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDFFSQLDQRVLSVFLKACDELTDILPEAEQQELQETVRRLHKHWKDVQAEVPSHL
VRLKVEVEQRRVALVLQDCRLELSREIEALSGTCTSERVVKEHRAYFAERKPLASCEKWL
RVMEELCQQVPDNDPAHRSLGAAAGDLAAVTDEIENTRLKLLQHPDKWREWNDRFCELSD
WLSSQRRQVRSLRETAGDLAHQEQVDAALQALQEAVDEREETLCWLKRRLAALSEVSPEL
EVQRERAALAKLSTDLRALLSSLCQVFQSEELREEVRGALEEVHRVRREAQEHYGRVLEA
ETLGEARQLYLIHQQHLKRLHAGRKEADLLVAHCRQLQKEEGLSRSLGELEEAFGEGDLK
SDAQGHNLQTALRAWQEFESERESIWKFLTSTNAGLAKELLFNSQHSLKTELDLSKELFS
RGEEWTTRAKSLLETASGVHLGAKNQRLLLEQARSTMGALAQLQEHLRKNINQLELVHTW
WEHSGSQSEAFFLWISEKERELEDISPASSPDSLDKQLSSVEAVEAALEEKRAWLVQLEG
QSQALSGYVTPGEAGHIRARLGQMGRGLEEFRGSVRQLIGQLQQSASHRQRYSDNLEQVT
KSMSDLEEKLDLQITFCSSSSETYRGLQEHMEQCQAVEQLTPRLTALCSALKRLGDGGPL
EEEVARLQERQREDVERAKEKQAALENLLTLWQRFEKESSSIRSWLDRCEMICCPDIHHL
SADKVKLRNELQNIQEMQSEAPANETALEGLLSLRLSLTPTVPKECVRDITDDITRLHER
CSSLKDSVTHRLELLETHLSRLEVFDKHLVTLAQWSDNFLSGLRSSSQVDMEDLEAAVRQ
LQEQETGLLEPAPLQETLHGVESSLLPSSTPEARQQLQGWREECLQPLGEAQRLLRLRGA
CLAELGPFLRRHGGPAVQDLREALEGRGSWDRSKAXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRTFVQMEDELQCLQHSRDWL
GERGSQLAQRDSELAGDALREVGLVEAAWTSVTALITHGQEQSGAVIQLLRQFHALRSSL
GVALENAQAVTHSLPDHNHSREEVRRILVRHEAAQAELRDGQESMDLLISTEEDLQREME
KTPGPDTQTIQRDMETLRDQWLEVSERLQTNGERLGYCVALWDDLKATEQDVGQWASAAI
VDLTDSVANLSDGQKAEARLATFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVL
ESDLRKKMAHAHEVYNQAKHALTYFSFQRQRLEDLASQMTARLEAVEGSLAGLSESPPQN
MDTVKDLQGAVQRQRADLDTARESLTALSRSHPSPELSRLSAELTAIAKGTEAAALRXXX
XXXXXXXXXXXXXXXLVQEFQSWLAELQLELRDCSSQSGDGAALKAKIYRLKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XFEERVAGIKGWLEQLEVSLKKEPVLGPDGQQGALDSAEELERMEGIHKELLQRXXXXXX
XXXXXXXXXXXXXXXXXEARVGSRLQADHQALLRAARDRLRGCQESQAFGETLQGVWAWL
EEIQERLGTVDSTMGTKEQLEQKLETVQDILLLKGEGEVKLNMAMGKGELALRGHGEAGQ
EVIRSQLQEVEDAWATLLVSAMSCHSRLEWTVSQWGGYLDSATQLRCWMGALEGDVSAPL
PPQPGPREKASQLDRLRALRADLEDHQGALSSLEEKARELYKKTGDCGFSHASRTQLQGQ
FDELTALVEGRVRRAQAVVLEHQEYLEAVRDLTDWLMSAGEELQHWSDTSGDSASVRKRL
SEVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGWSQELVRAEGRSNGEEAVEGW
RMAKGILEGLTTAEPMAEKLKVQLNELVRYSRDLGAPSDRVTALIKQHNSLSLRASRECQ
NKERLLEQRFRAALRDFQQWLVNAKISTAKCFDVPQSVAEACTALQKIQEFLSDREHGQC
RLSAVGASGELLMVVAAPDRAEGLQAKVDNVREDWKTLMASLQTRQDALKNLESQMRDFE
ACAEPLQDWLNGTEVKVQESSARLHDLAAKTQELGKLQCVLEEMSGREAELGRLRERAHL
LWEGQAAGKGFVHRVSQLSAQYLALCNLTKDKASRIERIVGEHRLFSGGLKELQDWVCEA
QRVLNTCLSPTADKSVLENRMMQLEALLAARQEREIQLKMLLTRGEAVQRNTSAEGVPVV
RKQIQDLKDSWDSLLSASIQCKSQLEGSLSQWTSYQEDVGQFVVWMDRVDETLGCSDRQY
SEMRDKTANLGKTKLLYEEVLSHSSPLETIATKGSNMAEHYITQQEVQQLHLRYSALKDK
AKAAVSRAKELVLVHQEYQRGLHVFEDWLEQEQASLASLSHPEGNVDTLEETLRQLQLLQ
ERCTEGQSLLSSVLTSRDKVIPWGAPQIEDRALDTAQRDWGAFQRRLEETRAHLSSTLAR
LRQIGQRFQSLSQWLEEMERRANLRSHRRSSRSTKEAQLKQLQGWYEAVVGRQGEVDSLS
SLAQQVLEETHINSRVSATATQLTASYHALLLYLQTMKQIQEEVRSIVEAEKLCASFSDW
LNCTQEKFVQVIDSSEPLDWLAMEKKMKKLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXEAQLAQLEELAGGLRQEHGSLERALLLAKEFQDRYKGQAQWLVETRALVS
GPVEPKAELYQRRAQLAKYKALLQTIQSHDGAVKSVLEKGEALLASVHFPSIRDNTNRLH
NDYTTLYTITAAHVENLEEQVKEQEVYHGELQEVERWLLQMSSRMVTPDPSVGGGLDEAT
QQLARHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXQSLDRELQRHVSLQDALQQCQTWLATVADEPEPPAHPPVSLEGALVQVKQER
ALQEQASTYLHLVCSTCDLTEQRVREAANAIQEVKLQVEDRMLMCEEVADSWREVEEQQA
DLKVQLREMDQHRQSLARRPAELEPKIAQNQLDKAQEFLQQVRDRQCDVTHLSDTLVRLT
DGQGCPALEAVGRLRGSWVELGQRAEELEAQRGEDMQHSGEYQESVAAVEELFHQVSREW
DYLARADTESTSEHLEALKKLSSDLQEQRATLEDLREQKHTVLPRLSLLDKELVKQQVGY
LEQRWAQLEGLIQKKIQDSAGTLEDMARVEAQLRDAREWVEEQRPSLTSALKTSPPPDVA
QSFLFDHLSVCVELEARQQLLGQAVSEAKAVASRLGLSEKRSLQELVEQAQSEVEALGAR
VTQRRKYLSKAFTERTQFLQGLGRALAWVQQQESKALVDGHVALLPEDLAKQVAAGQGVQ
RSLRTYQGELASLWAQGRGLERDATDHERVETLARLEELQVAFETVQQRTAQRLTDLDKA
MTARKYFQIDLDKTCGWLRQADTVTFPEIDLTDAPQSSDLQARLSCYQRVLEQASEYENL
LLIVQRIGQEILPTLNEIDHCYLDERLNALPQQYNSILALAKEKRDRVQQAILERNDFST
FLEITRNALEELKGQHDNLEKQAVAASEEEVARRRDEYGNLEGSLAHLCPAVREHGETGG
LPSRGQRCSVEEIQRLVAIHDTLKRQIDQKRKLLGACLETVVEHNRASAHFESECDAVRG
SLVRLQSDDRLCATDSLTGVLGLLESVESLSSQAEGCERKLKSLNVNFEPSAIQDVTLRQ
ESLRSLQSEVRRSITEREKNVCQNEDFTRGTEKVLAWLVAMKDKIEEPLAFSEVEVENVQ
EELRRLRIVEEEVEGVLRVAGALGSREKQRFDGRKEKVPASVEKQLQRLHKLEAEVTKAI
STKQLAVDQALPLVQSYSDSQRSAQTWVDAAGAALHGAGLGVDPEDQSESSRGLRDLLDR
DGAFGAGLEELRALQPLLKPLVRPAGAMQELRRRVEEMRLRNITLRQQLEERHQALQSAA
SLWSSFQQEREALIGWMNTAENTMSSFPSAKAAGLLEAEDKFHSYKSLLGGMDSAERSLT
ALREKASALETLGSEAGRAAVAGHSVSSLWQRLTRLRSVARGQERALEDTVREWRKFNEK
MEKARCVSADLGGRVPDSTVEKAATRAALQSLLEYHDSYGRELEREQSCLALLGQHTLWL
RGQEEELGEVEEEAGNGKEERRRGGTPCMREIRSMQEKYKSLGVQVRSSRGQVQQELRER
EEVEKELGLVKGWIQDTRGLLLSPTADLDSLLQELETAHGEVISRRQSVERMAELQQSKY
QDLPAGLPSELSMQLAEVALALGSAEDQVQAREREVQQTRDVKEDFGARLKDMEGRLRSV
SRKLEDKPSDLEQAREETKCLCEECEGCGGSLAELGVAVQEFGEQNPLLCRQLGDSLARL
GETQRLTAQQAHHRASRLKEAERQYEEYKGMRSFIMGWTEKAEALVTGNIIWSSASQLQE
QIRAHQALLRECRGLHGDLEAMAEREGQLGQVVRTRGWSQQVNHLSRRAEELQQHARTRL
QSLQDAAKDMMRLEAEVKSLHATLEQVQTTLASPDLNRLSLREQLTHRQRLLVEMEGFKQ
QVTTVQQCQSALRLPEEVVASLPICRTAQSLQHEASQLQHTTIQQCNILQEAVVQYEQYE
LEVRNLQRLIEEAHRIIQDRPVSTSNIQELQAQIHHHEELAQKIQGYQEGISSLHSKCKM
LTVKAKHATMLLTVGDGDGLSDGGEDLSDEXXXXXXXXXXXHPSVVMMTAGRCHTLLSPV
TEESGEEGTNSEVSSPPACRSPSPGAGADAPPHQRAPLQELYDPSMESSAANLDDLQKSW
ETLKNVISEKQKSLYEALERQQHYQETVQSVSTKMESVEGALNESLEPSKTPESQMAAHQ
ALMDEIMMLQEEIGELQTCFSEELLGDGDGDGDGGDQLALRSTLTVLGERMATIRMKASG
KRQLLEEKLGEQLEEQRQQQTLQRYHVQAEELNHWLLSTQATLSSALQPQGDSLDMEEQL
IDCQNMLYEIERKVASLSELSVHSESLLLEGRAGPPGGEAEQLTHKLRSLKDSLVELQRM
LHDKQVDIQGTLQEQEDSETDSVLSQSPNVQDWLSQARSTRSQQHQCNLLRQRELEEQVA
EQRRLLQSVASIGEEVLSQHAPPNGDSEVSVPGGVLLEAESFSPLEQLRQRWENLKRDQS
TKLQLSLTSLEQEQQVLHRPRLSSPGVVLRGEPPSQDPRSPRALFEACNRTLDALAQETS
CGDAKARPGEAGVQQELCVAVATASTWLDAAENQLLSGPVLLSEDTESQLYTMEGLGREL
KEVRGEASRCRALGGGGRLWDGEERGLMEDTLGGLMERLELLDSTLEQQCDGMRDRLQDH
SAFQNELRRLFTALGDSKQAVLQRKTGAVDKPASKQIEALSEVEESLREFEQRVAELKSK
AESLQSDQVSKQELLKLQDAYGELVLMVGSRRSSLNHSLSLKAQYEAALHDLADLVDTAQ
DKMAADQKITVASVIDVQMLLDKHKEFFQGVERQMVLSQAFYSKVSGLVGPRESQALEET
MGAAHSTLKQAHRRGVELESILESWSRLLEDYKALCGQLEAVEGGVPTVVLVEETEERLS
ERINLYQCLKARLTEHQPQLYQVLEEGKRLLLSVCCGDLETQLTTLGEHWLCSTTKVNRE
LHRLDSTLKHWSRYQRESSELSQWLRWALDRLGFWTTQSVTIPQELETVRDHLSAFLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQ
MEKLASRHAIQELMSWISLMENIIGEDQDRISSAVGSERVQDFLQKYKGFRIDRTCKQLT
VDFVNQSVLQISSLDVEGRRSDKTDFAEKLGAMNRRWQVLHGLINEKIQLLEGLLEGWLE
HENGVQALKAWLTLQEDKLKKKHRIEDVASVQSALKDCQELEELVKEKEKELEKAEERGS
ALIQDKKGEACSVVRETLKGLNQSWAGLDHMMSQMKLSLRSVLERWTSYRREAEEIGGYL
MEGRYAVSRLRLLNGSLEAVQQQVSSLESLQEEMDKQESSLGKFGSVTHQLLTECHPSVA
DTLNRALRDVNIRWNGLLEQISEQLRSSKALLGLWQSYQAVGGQCVTAVQRQEDRANRLL
KSATDRDITEQESAAWVRDCDACLGGQAPVQQSLQQLQALGEQLKSQVDASSVAALQSDH
RSLVHRLATLEHGLHRHQEILQSGTQDYELFRGQLDTLCSQASEAGLALKEVDPVGTPEP
TVVQEHMERLKVHLLQLSSLSPDLERLNELAYRLPLSDRDMKRLQGLNRTWASHSAHLTE
RFSKLQAGLLQHQSFLQKCEAWMDFLSQTEQKLAAEISGNLLSLMEQQRDHELFQAEMFS
RQQILYSIISDGQSMLHQGQVDDREDFSLKLALLSNQWQCVVRRAQQRRGIIDSLVVQWQ
NYRQMADKLRRWLQEVSRDPDVHQQGEAVALQEARAMLDQIQLRERVLQRQQGAYILTVE
AGRSLLLTADGRVESALQTELMDTQERWRHAHQRLDQQRRELHGLLKDWGRCEKGIDASL
EKLRAFKKKLSAPLPDHQEELHSEQIRCKELESSVEGWTDDLTSLFLLRDSFGGVVSADD
LTLLQERLQLLQSQWDEICHQLSLRRQQVSEKLNEWAVFNEKNKELCDWLTTMESKVSQN
GDISIEEMIEKLRKDYQEEISVAQGNKQQLQAMGERLSRASQDSKAAEIQHKLSKVSERW
QHLLDLIGARVKKLKETLLAVQQLDKNMSSLRSWLAHIETELSRPIVYDTCDDLEIQRKL
NQQQELQRDIEKHSTGVASVLNLCEVLLHDCDACSTETECDSIQQATRGLDRRWRAICAL
SMERRLKMEETWRLWQKFLDDYGRFEEWLRTSERTAALPNSSGVLYTVAKEELKKFEAFQ
RQVQECLTQLELINKQYRRLARENRTDASCRLREMVHDGNRRWDHLQRRVASILRRLKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFQQEIQLNTGRMELV
LRQGEGLLEKSEPLDAAVIEDELGELRRYALEVFGRVDRYYKKLTRLPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHLRQRDPALERQQREGLANGSSPELD
SSYMGYMRLMGECRGNMDAVRRAEEELTEEEEDAPGLTNPISTDAQSAGVIERWELHQAQ
SLTDRHRQKQKQLISDLQTMRAWLGQSEAELGHLRSLDLSTDIQAIQQRIRKLKELQKSM
DGHKSEVLSINLSGSEFLQSEPDSEEAWALRDGLKEMNSRWERLSSSLEAWREELQRALM
QCQEFHEMSHGLLLWLEHIDRRRNQXXXXXXXXXXXXXXXXXXXXXQIKQELLDSQQKVS
ALQELSTQLLPRPRAGERLEAQEKVHVIWNRLKLLLREVNVDLEELERRLEAGQPRGKSS
QARAGYPSRGPRHSSDRTGGLWTSSSPPAGPSFLLRVLRAALPVHLLLLLILGLACLVPM
SQEDYSCHHANNFARSFHPMLSYTNGPPPI
Download sequence
Identical sequences ENSGMOP00000016299 ENSGMOP00000016299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]