SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016338 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016338
Domain Number 1 Region: 227-438
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-54
Family DBL homology domain (DH-domain) 0.000092
Further Details:      
 
Domain Number 2 Region: 428-571
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 581-641
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000407
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016338   Gene: ENSGMOG00000015237   Transcript: ENSGMOT00000016754
Sequence length 660
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1269:331923:343900:-1 gene:ENSGMOG00000015237 transcript:ENSGMOT00000016754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGGSLSPPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXRHSTQGPEMSWEDYDSDGDGFSLRRNRRNKSYRVAILDLD
GAGAAAAALMTPVREQRCASPGARPERAQKRTIGRKRNQKHGGSFKNATPRLYQEICERG
LQSTNQDELIDDFVVVEAVEDQGIVVKSYRPTQLIWSHLPQVKEGGILTITPEERKRQEA
IFEIITSEYSYLHSLGILVRHFKNSEPLRQSMTATEHHHLFSNIAVIEGVSKKFFEDLER
RHHAHPVIRDISDIVQHHSTHNFEPYIVYCSNETFQQRTLQKLLTSNTVFKETLKQIEGS
ADCGGLPMISFLILPMQRVTRLPLLLDTICQKTPDKTAEYFAAVWSLHAISKLVNSCNDG
ARLMERTEQMYTIQKQMDFGKIKPFPLVSSSRWLRKRGELAMCTEEMSIWKAFSHRSYYL
FLFNDVLIVTKKKSEESFVVTDYATMDNVEVEMGEDAEGRSTLGRSGSGHQVSFRLRMSK
NSDGKAEQITLATESRVDRARWVSALREHKQDGVVTSKEGLAQYETTKAYMPREPDELGL
RPAEVVILLGKELDWCHGERMRDGERGWFPANCAKEITNLTAMEQNVQRMKRLRKETNVC
Download sequence
Identical sequences ENSGMOP00000016338 ENSGMOP00000016338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]