SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016416 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016416
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000528
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016416   Gene: ENSGMOG00000015327   Transcript: ENSGMOT00000016832
Sequence length 128
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1407:9231:10773:-1 gene:ENSGMOG00000015327 transcript:ENSGMOT00000016832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHELNEEQLQDLYAWIDQIPLSRPKKHITRDFSDGVMAAEVVKHFFPKIVELHNYSPAN
STQQKMSNWSILNRQEMMVTKVFSKLDFDVGEERIKKIALRTAGVIEPVLFSLREKIDLK
LEQVTENL
Download sequence
Identical sequences ENSGMOP00000016416 ENSGMOP00000016416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]