SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016430 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016430
Domain Number 1 Region: 191-529
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-91
Family Myotubularin-like phosphatases 0.00000717
Further Details:      
 
Domain Number 2 Region: 39-171
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-21
Family GRAM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016430   Gene: ENSGMOG00000015321   Transcript: ENSGMOT00000016846
Sequence length 749
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2946:90685:110258:-1 gene:ENSGMOG00000015321 transcript:ENSGMOT00000016846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTVRPLKPTFKSYLPPLQTDVKKSLHPPVKKLEATLLPAGEIVVNEVNFVRKCIGAEKS
HDDLWGKLICTNFKVSFVRFQVSNRLLGEHDIPLACVDQVVTVNDAKGKKKVLGSNQKLK
FNPSELILYCKDFRIVRFSFDEAGPEGAKKVCLAIAHYSRPADPQLLFGFELIGTRYLGS
SGGSQTPLFACSSDWDREIKRTGAAEWRVCSVNQGYGVSPSLPEFFVVPASLADQDLRQY
AEAFSGQRLPVWCWNHPNGSALTRMAAITDPLQQKRLDQRICNAIIKSHPQRGDVHKADL
DKNLPSLQQVNNSLVRLRHICVIDPFEETEEKWLSSVENSQWLDYVRTFLKHSCDVVYIL
EGLNASVILQEEEGRDLSCVVSSLVQIMVDPHFRSLSGFQSLVQKEWVMAGHRFLDRCNH
LKKSDKEESPLFLLFLDCVWQLMNQYPSAFEFTETYLALLSDSMWVPVFSTFLFNGPKHH
ADTMHDFLEDKKITLGEGEELCLPPVWDWSQQLSITDQALFNNPIYVGKAAPYAHNGAVK
SFRRTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSLYEPSPPPEFLSSSFPFTPVGNLC
RPNLRGTPISKLLNGAKTWLSTETLAGET
Download sequence
Identical sequences ENSGMOP00000016430 ENSGMOP00000016430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]