SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016524 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016524
Domain Number 1 Region: 1-343
Classification Level Classification E-value
Superfamily Sema domain 9.81e-62
Family Sema domain 0.005
Further Details:      
 
Domain Number 2 Region: 346-395
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000227
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016524   Gene: ENSGMOG00000015428   Transcript: ENSGMOT00000016940
Sequence length 496
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3309:57087:118105:-1 gene:ENSGMOG00000015428 transcript:ENSGMOT00000016940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLVECGSVFRGICSLRNLSRVEHLLYFSDTNGEKSYVASAEEAVSVVGVMSFYNDSSSNF
SVFLVGKGYGSHDSTKLISTRILKPHGDWVVFDSIIEASSVQASSFVLRYLHDFRFVFKD
GIYVYFLFSRTLGVQENKNFTFLARMCENDHSYYSYTELQLNCSRANTFNKVQVGDKAGG
VRLRSRGDSGMYPLPTINKWLRDIIQACYSESGLINNKQAVYYPYTSKTEEKDRADRFKC
GEEFLPSPLASTPEFALTTEPTLVRKGHVTAVAVALEMEHAVAFLGTATGEVLKVHLSAQ
TPEVYGRTAGEVTGDKVNKNLLFDRHLQHLYITTETKITKVAVQACHLKTDCHSCVSMRD
PYCGWCVLKGRCTRKLQCERSEEANTWLWSPAQRCVRIESFNPASISCKKTDQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVSVPMRVMV
NDTIEVTSGEYHFYDC
Download sequence
Identical sequences ENSGMOP00000016524 ENSGMOP00000016524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]