SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016525 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016525
Domain Number 1 Region: 317-640
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.07e-132
Family Mammalian PLC 0.00000000187
Further Details:      
 
Domain Number 2 Region: 883-946,983-1154
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 8.11e-62
Family C-terminal domain of PLC-beta 0.0000362
Further Details:      
 
Domain Number 3 Region: 175-314
Classification Level Classification E-value
Superfamily EF-hand 1.15e-40
Family EF-hand modules in multidomain proteins 0.0000212
Further Details:      
 
Domain Number 4 Region: 16-146
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-28
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 5 Region: 660-778
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.18e-24
Family PLC-like (P variant) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016525   Gene: ENSGMOG00000015392   Transcript: ENSGMOT00000016942
Sequence length 1197
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2412:1056:139970:1 gene:ENSGMOG00000015392 transcript:ENSGMOT00000016942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAQPGVHALQLKPVSVPESLKKGNTFMKWDDDSTTVTLVTLTVDPKGYFLYWTDPNKX
XXXXXXXXXXXXXXXXXXXXXXDAKLRELLDVGTLVGKMENRMLTVVSGPDMVNITYLNF
MAFQEEVAKEWAEELFNLASNLLAQNMSREACLEKAXXXXXXXXXXXXXXXXXXLFRMFS
ADRKRVETALENCNLPTGRSDSIPQEDFTPDVYNMFLSNICPRPELDHIFSEVGARSRPY
LSMDQMTEFINSKQRDPRLNEILYPPLKAEQVQQLMDKYEPNVSLAHKGQISMDGFARYL
CCEENGIIPPEKLDQSEDMAMPLSNYFINSSHNTYLTAGQLAGSSSVEMYKQVLLSGCRC
IELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPVILSFENHVDSPK
QQAKMAEYCRSIFGDALLTDPLEKYPLESGVPLPSPGDLMGKILVKNKKKHHKAGGSGKK
KLTEQSGEVEAESDDDDDDDDDCKKGSMEEGTAGSEAFATEEMSNLVSYIQPVKFHSFEG
SKKVNRSYQMSSFVETKALEQLTKCPVEFVEYNKMQLSRIYPKGTRVDSSNYNPQLFWNA
GCQLVALNFQTIDLSMQLNLGMYEYNGKCGYRLKPEFMRRPDKHFDPFTVSTVDGIVANT
LSVXIISGQFLSDKKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWDEEPIVFKKV
VLPTLASLRIAVFEEGGKVIGHRIIPVSAIRPGYRYIGLRNEKNQSLNMPALFVYLEVKD
YVPDTFADVIDALSNPIRYINLMEQRANQLAALTLEEEGEEGADKEADAGGDAPSEPKVD
QRAAVPSENGLSHTPVSAPKPPSVGGHQPQPTGSLKPLVKSEDIIHTVLTEMEAHSVEEL
KQQKGFVREQRRQYKEMKELVRKHHRKTGELIKEHGARAGELQSQHQRRRSALVKSRKRD
GKKSRSEASLSSLDQELGEVEKEWAQQLADLKEQQQQQLLALRQEQYYSEKYQKREHIKQ
LVEKLTAIAEECQSSQTKKIRDICEKEEKDLKKKMDKKRQEKINEAKSKDRNATEEVKME
INRSFVNEVVQYIKRLEDAQGKRQERLLEKHKDVRQQILDEKPKLQSDLDQEYQDKFRRL
PVEIQEFVQDSSRTKLRDDPSLQSSLSVSSSERLSKALQSEEETEDGSTERVYDTPL
Download sequence
Identical sequences ENSGMOP00000016525 ENSGMOP00000016525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]