SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016620 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000016620
Domain Number - Region: 104-202,305-355
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000417
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 13-151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000719
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016620   Gene: ENSGMOG00000015506   Transcript: ENSGMOT00000017038
Sequence length 361
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1945:13810:18727:1 gene:ENSGMOG00000015506 transcript:ENSGMOT00000017038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DARQVLALQRAKLCRVGEELGSRYPEVPADIGRRLGEAQHAVRTAEEKLLERSDPFHKLS
SSALEVSISLEALKTLLDTRSPSFPEAQDKLKHVWDELDTQHSRLGVLESEAQDLAEERP
QQGHLLMDRLSGPLQLYQDTAQLAEQRTAFLARIPAFLQEFEDILHSATCWLGDAQSWIS
APCTYSTARSLHSHAKSLQLVLEDSERTRATLGSLGLLFQVMSAVWDTRAGQRLAWTERQ
VEGMQHNVYEPMEQLLHIATEIDAMELEVKTMEKNATKIRSILTTMSSRNISEAECLESR
QVILDNLQSMQGTLEEIEQCKGELQLPAGALDTLTVFPRAQLLLQSLQELQEWTQRQGTL
Q
Download sequence
Identical sequences ENSGMOP00000016620 ENSGMOP00000016620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]