SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016637 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016637
Domain Number 1 Region: 1-431
Classification Level Classification E-value
Superfamily Sema domain 5.89e-152
Family Sema domain 0.000000000363
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016637
Domain Number - Region: 525-609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00308
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016637   Gene: ENSGMOG00000015502   Transcript: ENSGMOT00000017055
Sequence length 684
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2:22673:43948:1 gene:ENSGMOG00000015502 transcript:ENSGMOT00000017055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQALLLDEDRGWLLVGGKDHIYLLRSDSLDLPTRTIYWPASPDHVEHCRQAGKSLEMECA
NFVRVLQPFNKTHVYVCGTGAYDPQCSYLHLGDSSQDPVFLLSPTVESGRGRCPFSPSEP
FTARLTDGELYSGTSVDFMGANAAIFRTAVQANSQDYIRTEAYDDHWLNEPEFVGSFSIP
DTHSPDDDKVYFFYREKAVEGGQWNKMIHSRVARVCKNDVGGKRSLINRWTTFQKARLVC
SIPGPSGMDTVFDELQDIFLLETKDPQNPTLYGVFTTSSAVFRGSAVCVYSMASIRAAFN
GPFAHKDGPDYRWTEFRGRIPTPTGTCPSETYDALYRSTRDLPDEVVSFVRQHQLMWEPV
LPLGNRPVLTLSSAPYCLRKVVVDRVETDEGPFDVLHLGTDDGRLLKAVSVMKDSRHVEE
IILEELTLFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXRSRRQDVRHGDPWSQCPQSDNQADSVETKVLYGVEGNSTFLE
CVAKAPLGGLRWTXXXXXXXXXXXSDDSRSHTIKRGLLVQRLELAGGFYTCTAHEHSYSQ
VLARYQLHVIPQRSLHLPVALGPVAWPRRRPPRGYKDLLLAGSNSLSQDEYCEQLWYREK
RRQQKLRALKLKQESRKARVRRNY
Download sequence
Identical sequences ENSGMOP00000016637 ENSGMOP00000016637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]