SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016677 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016677
Domain Number 1 Region: 2-382
Classification Level Classification E-value
Superfamily Sema domain 5.76e-101
Family Sema domain 0.0000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016677   Gene: ENSGMOG00000015558   Transcript: ENSGMOT00000017095
Sequence length 406
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3894:43562:59054:1 gene:ENSGMOG00000015558 transcript:ENSGMOT00000017095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDCNNYIRLLEILDDDRIYVCGTYAFDPQCAFLXXXXXXXXXXEEQEVRMETGKGKCFEP
SQHYTAVMAYTAATSNFLGTMFDISRATGPEQGRIRTERSINWLNDPEFVSASFIQQDPT
SEPLGDDDKLYFFFTEVAKEYEMYTKVKVPRVARVCKSDVGGMKTLQRRWTTFLKAQLVC
EDRPSGQRYNVLTDVFTLRRDPNDPATTQFYGLFTSQWREELAAVCVFSLSDINKVMDGP
FKELKKTCENWINPEPVPRPRPGQCLNSALRAEGLESSLLPDKVLTFTRDHPLMENSVTA
APLLLRRGVTYTKLAVTLADAGPGALLHLGTDRGEIHRVAVVGQNTTLLQEVPLFPADQP
INNIVLHKGQALVGTPQFLARVSAQGCGLHPSCEVCARARGLGCTW
Download sequence
Identical sequences ENSGMOP00000016677 ENSGMOP00000016677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]