SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016695 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016695
Domain Number 1 Region: 788-974
Classification Level Classification E-value
Superfamily Fibronectin type III 2.5e-32
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 587-784
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-30
Family Fibronectin type III 0.0000757
Further Details:      
 
Domain Number 3 Region: 403-500
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 496-592
Classification Level Classification E-value
Superfamily Immunoglobulin 8.75e-18
Family I set domains 0.005
Further Details:      
 
Domain Number 5 Region: 302-402
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-17
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 2-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000615
Family I set domains 0.0056
Further Details:      
 
Domain Number 7 Region: 251-318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000048
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 108-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000308
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 1071-1150
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000148
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016695   Gene: ENSGMOG00000015532   Transcript: ENSGMOT00000017114
Sequence length 1298
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2300:32445:83561:1 gene:ENSGMOG00000015532 transcript:ENSGMOT00000017114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPTIIKQSPKDFIVDPRDNIIIECEAKGNPQPRFTWRRKGKFLNTGKDPRVNMRKRSGT
LEINFRSGGRPEDYEGEYQCLASNDLGVAVSNKILLRVSKAPLWPKELLEPVLVSEGHSL
VLACNPPPGLPPPYTFWMNSAMIPIPQDRRVSMGLNGDLYFSNVLAKDAHTDYSCNARFL
FTHTIQQKNPFSLKVQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXIKWFKKGGDLPAQKVKFENHNKTLKIVSVSEEDAGEYVCLANNHVGGI
RHNIHVQVKGAPYWLDKPTNLVLAPDENGRLVCRASGNPRPQVQWLVNGEPVESSLPNPS
REMMGDTIIFRSVQIGSSAVYQCNASNQHGYLLANAFVSVLDMAPRILGPKSQLIKVIEN
NRTFLDCPFFGSPLPDLRWFKNGQGSGLDGGHYRVYINGTLEIKRARTEDEGTYTCVASN
IMGTVENQVILEVKEPTRIVRGLEHQSAFRGSTARFDCKVKSDPSLPVTVSWLKDDSPLS
LGWRLRRDEESLSIPNVNEGDQGVYTCTAQSEIDQDVSSARLTVLADRPDPPMDLDLSDL
AVRSVRLTWIPGNDHNSVITQFLVQYEEDRWEPGSWQNLTSYPGDLNSVILQLSPFINYQ
FRVIAINSVGQSAPSHPSPRYKTSGAPPDAIPSGLQGWGTKKNNMEISXXPLLNVERNGP
NLHYQLWWRRKDTGEAWSNVTTTGSKHVVHDTDTYVPYEIRIQALNDHGAGPTSNVATGY
SGEDKPTDAPTNLRVSNVDSTSVTIHWNPVDPSSVMGEFKEYRLYYWREASLLKGLRVSQ
EKMTRGFYSIAAQAVLGGLVPFSHYRMLMVVANRGHEGPPSNTVEVRTKEGVPDAPKYFE
IVKRALDTIHLQWDKPLEPNGVLIGYQLKYHTGGRPYRLETFPPNITQYTMRLPDRATRY
KFFLSALTQVGAGEAFTGEFPRSANEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREIWNLTVKPNSNY
ANVNWTHNFPPGTTEFVIEFTLDSNGTVRTVPVKQQPPIKVGDLIEGAKYRLRVYSHEHH
DISSQSFTFETGTAYSKDQVDIATQGWFIGLMCAIALIILILLIVCFIKRSRGGKYPVRD
KKDLALDPVDQKEDGSFDYHFSSDEDNKPLQGSQASLDGPPKESDDSLVDYGEGGDGQFN
EDGSFIGQYTVKKDSKDETEGNESSEATSPVNAIYSLA
Download sequence
Identical sequences ENSGMOP00000016695 ENSGMOP00000016695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]