SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016719 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016719
Domain Number 1 Region: 1035-1151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000168
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 2 Region: 924-1047
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000864
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 664-706,814-922
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000202
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 4 Region: 1537-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000648
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016719
Domain Number - Region: 90-201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00112
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 295-396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016719   Gene: ENSGMOG00000015524   Transcript: ENSGMOT00000017138
Sequence length 1781
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1945:24498:69313:1 gene:ENSGMOG00000015524 transcript:ENSGMOT00000017138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELQWRSIQRRTEQEIRRCQEIQRSWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXDFSMEVEARAAQKASIAREGALLLGLREADSPWLRGLLSALEVTWSQH
TSDLAKAQERLQQLVVVVWPPSELLSDLRGWVEKVENRLGEERGKPQATDASQLADTLQH
LQELNVGVSCGQVLLDFLWQSGPRSDICVFSWERTLFTETIGELLEWACLQGELMSQIRL
VGDMHHMCSHREMRLGRIGDWLARQAAELERWDRPASQTEARKALLECQAEALRPALERI
LVEWSQLETDLSEVSLYTTRLRCVLQQLLHTPAFSPKQVQKQLEELKQLQEGAGKGVKLC
VAVDQSYQALEGKVNDVTARLLKERIEGEQRRWEEARLEVVAAVRGTGQTLALWQGYVQQ
RDSCTLALQQARLQWEEPRKAPEDLELHQRFCRGLEAVELQTQELANELSGRSRGEGERL
GVLWRQWAEGLTHAADIYSQSFQQKSDRLAIIQGAVKEALGTRDTGRSSSLLKRLATHQR
LQRLVVELVTGQWLLGALFRDSVGLQTNTTEEEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLEETMATH
GPVYGQTLEVGRRLCASTTTSTEPADHGQLFKELRCLEEAWEQTSTLLGRRTALVNTVLQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSSRRQEITDRLDAWTLFNDKNKELC
DWLTGMEGKVLHHDGEVGIQEMVEKLKKDCMEEMNLFSENKKHLQQLGETLLQASGQAQH
GTLHSSLQEVNQRWHKLFHSIQTSRVRKLKETLTTVQQLDKNMSSLRSWLSRVEAQLYRP
VSYSVCHHQEVQHRLAENQELQRDIEQHMEGVASVLSLCDVLQGDEDAEGEGDSLLETSR
SLDQRWRAICALALDRRLRIEETWRLWGKFLDDYARFEDWLKMAERTAAKPNSTDVLYTV
AKQELKKFESFQRQVNERLTQLELVNSQYRRLARENRTDRASQLRAMVHQGNQRWDSLHR
RVAAILRRLKHFTGQREDFESTRESMLVWLTELDLQLTNVEHFSQSDVRHKIEQLNXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EEPEPFYNSVTLEESLELIGRPWLGRGSLPATPTHLLSSPMERSGCGTPVSVDSLPLEWD
HTGDVGGSSTQEGMYFSVLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDSEEQLETPPQAGLTS
TDAQPVGMESWMDVPEVQSRIPQEPRTHMTSDGEVTSWLALVGPELELIQRRDPATSIPD
LESNASRPEMQREFAGYQSVVASAGWSALDGGETEGSLLGELNRGWGQACTGLQDWEHSL
RTNLLHCQEFNGALHSLLLWLAQAESKCHAVDISQSHAPSALRQHRCTLSVLQADLRSRQ
SEQRSLQVLWSQLQPRHGPTAEGTEAQEKLHVTASKLRSLLRHVERDLSRLDQRMXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRADPPPPRRSFLCRVLRVALPLHLLLLL
LLLGLCCLVPRPASDPGCSLTNSLARSFYPMLRYTNGPPPT
Download sequence
Identical sequences ENSGMOP00000016719 ENSGMOP00000016719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]