SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016786 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016786
Domain Number 1 Region: 49-520
Classification Level Classification E-value
Superfamily Sema domain 1.44e-126
Family Sema domain 0.0000604
Further Details:      
 
Domain Number 2 Region: 1366-1493,1689-1877
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.05e-49
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 1053-1157
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000171
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 4 Region: 868-965
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000446
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000262
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 972-1013
Classification Level Classification E-value
Superfamily E set domains 0.0000000471
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 
Domain Number 7 Region: 1168-1233
Classification Level Classification E-value
Superfamily E set domains 0.00000716
Family E-set domains of sugar-utilizing enzymes 0.091
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016786
Domain Number - Region: 820-854
Classification Level Classification E-value
Superfamily Plexin repeat 0.000327
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016786   Gene: ENSGMOG00000015609   Transcript: ENSGMOT00000017205
Sequence length 1908
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4098:131353:352496:-1 gene:ENSGMOG00000015609 transcript:ENSGMOT00000017205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSIPGTWARLLFSSCSYWPPVVRGSQVAGGSQVITASLLGEEDDEYLSFRAQNPVSTFN
HLAVDHRNGNVYLGAVNEIYKLSPELKYQMSHQTGPDEDNRKCYPPRIVQTCSEPLALTN
NVNKMLLMDYKENRLLACGSLYQGICKILRLDDLFKLGEPFHKKEHYLSGVNESGSVFGV
IVSYSNASPDMLFVATAVDGKPEYFPTISSRKLARNSEADSMFAYVFHDEFVASMIKIPS
DTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGGGPSTGSSSGGREQVYTSKIVRLCKDD
TAFNSYVEVPLGCVSGNVEYRLLQAAYLAKAGATLARSLDVGADDDVLFAVFSKGQKRRP
RLASQDSALCVFSLRKINEKIKERLQSCYKGEGTLDLAWLKVKDIPCSSALLTIDDDFCG
LDMNAPLGVSEMVRGKPLFSDATDKMTSVIAYVYKNHSLVFVGTKGGFVKKIRVDGSSRA
LQYETVKAVDGGPVLRDMAFSPDHYYLYAMSGTQLTRVPVEYCGQYPTCSKCLGSGDPHC
GWCVLHNMCTRKEKCERSSEPRRFASDLQQCVRLSVHPNNISVSQFSVTLVLEAHNVPEL
SAGVNCSFENLAEMDGLVEGNRIRCFSPAEKEVPRIIVDKGDHQIVQLYLKSKETGLAFA
NTSFVFYNCSVHKSCLSCVSSPYQCHWCKYRHDCTHDPRTCSFQEGRVKRPEECPQLLPA
DKILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGVEHRVPALRFNSSSXXXXXXXY
FYDGMEMSSLPVELTVIWNGDFSIDNPANNKVHLYKCDAQRGSCGLCLKADPLFGCVWCK
GEKRCTLKQHCPHPESQWLEHNGLNSKCTNPRITQINPLRGPREGGTLVTIRGENLGLEF
REIQGNVKVAEVDCTPIPEGYIPAEQIVCEMGKAEKSQFAGNIQVCVGVGECRPEFLASS
SKYYYFVVPRLIHLKPSRGPVSGGTVVNITGSNLDAGSNVSVLFKDQPCTLLRXXXXXXX
XXXXXXXXXXXXXXXXXXXDKAHLQKDQRFEYVEDPTITKIEPEWSIFSGHTPVIVSGTN
LDIIQTPLIRAKYNGHETLNMCRVLSSTSMLCHAPELPISLARQGDAPERPDEFGFRLDE
VQALLALNSTSFLYYPDPEFEPLSLSGVLELKPGSPIILKGRNFLPPTNGNGKLNYTVLI
GEKPCMLTVSDTQLVCESPNMTGRHKVLARVGGIEFSPGVVHITSDSPLSSTAIIGIAAA
GALLIFFIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTS
DLDGVGIPFLDYRAYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKQFGHLINNKTFL
LSFIRTLEAQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDRNLESNHPKLL
LRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSLS
EDKLIRQQIDYKTLVVNCVHPENEKSPEIQVKVLNCDTISQVKEKILDSIYKNIPHSHRQ
KASDMDLEWRQGRGQRTILQDEDLTTKIEGDWKRLNMLAHYQVPDNSIVALVPKQVTAYN
SVNNSTVSRTSASKYENMIKYTGSPDSLRSRTPMLSPDPESGVKVWHLVKNHEHGDQKEG
DRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADK
HSIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSE
HRLGKDSPSNKLLYAKDIPSYKSWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMSEFNT
MSSLSEIYSYVGKYAEEIVCALEQDDGARKQRLAYKLEQVVACMSIES
Download sequence
Identical sequences ENSGMOP00000016786 ENSGMOP00000016786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]