SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016837 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016837
Domain Number 1 Region: 1236-1396
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-64
Family Pleckstrin-homology domain (PH domain) 0.000000827
Further Details:      
 
Domain Number 2 Region: 1054-1235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-42
Family DBL homology domain (DH-domain) 0.0000000323
Further Details:      
 
Domain Number 3 Region: 440-540
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016837   Gene: ENSGMOG00000015633   Transcript: ENSGMOT00000017256
Sequence length 1530
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4339:7957:57655:1 gene:ENSGMOG00000015633 transcript:ENSGMOT00000017256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNGDSGIYGDVTGPLSRKHTSRSLRLSGKQQQQKQPIARRPRHSSSSVKQEHRN
SEASTRSSSTPSIPHSLAESGQDPFGGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEGRCLQRLAEGPGGGGSFKKKRSKSADTWREGSMELSES
DLSQGHMTSTEDMGGGGEEEEEEEPFARPRGAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSPAEDDGSGGVYGAFTLPCRRSHCLSEGPFQGRRAQTTQDI
SGALGEGSEYGDSGIDGLAVEMEGEAELVSRRCKAMSASFSVYSNAESSAFNGSTFHGSD
SGSSNGGGGVYENFRKELDNQAWTHRGRGFREEAGSAVSDERSSGTLSTAYPSDFPIGCA
NGTVRKAGALAVKNFLVHKKNKKVEPATRRKWKHYWVSLKGCTLYLYDTDGRSAIDHNSV
PKHALWAENSIVQAVPEHPKKDFVFCLSNSVGDAFLFQTSAQTELENWITAIHSACAGAV
ARQHHREDTLRLLRTEVRKLEQKIDMDEKMKKMGDMQLSTVTDGKKRKTILEQIFLWEQN
LEQFHVDLFRCRCYLASLQGGESPNPKRLLAVASRPTKLAMGRLGVFSVSSFHALVAART
ESNARRRSHAVPRPSSKRRSRFSSLWGLDTASRKKSKAPHPSITQVFVEGAEPLKTTLEC
MVEDSASEKSRGTGASVKSVPQLQPDSEIWTPECLKPSWVCLPNDRPVLAIIQPGETSME
TLDAVCKANKIDPSNHYLRLKVCVEDQMLLYVPSSEEDISDLLHKEIEICSKTTKVVCFD
KADSCAIGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKVGDEILLLNGKPASVLQMD
DMRSAFVQPALTLSVSTLPHIDPRLLCSLPPRRSDDPTTDIFSQDQGGXXXXXXXXXXXX
XXXXXXXXXXXVPLPPPQGTEQDTAFCRGLHDMNPPERPSSSFSSASSSTSSXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLGCLIERFLKPLQKESFLTQDELDVL
FGNLDEMLVFQVEFLQTLEDGIQLVPDLDKLERVEQFKKVLFSLGSSFLYYADRFKIYSA
FCASHTKVPKVLTKAKTDPDFKAFLALRNPRQQHSSTLESYLIKPIQRVLKYPLLLRELY
SLTDPESEEHYHLDVAVKTMNEVASHINEMQKLHEEYGAVFDQLINEQTLDKKEVADLTM
GDLLVHKPVTWINPPSALVKSKKDPELAAFVFKTAVVFVYKNCTKQRRKIGASHRSSVTE
DRDPVRFRHMISTDSLQVRPLASDSEDTAVCEIVHTRSESVGRPERTFQLSCSSPDSKKE
FLKAVHSVLREKQRRQLLKTDSLPSGQQYVPFGGKRLCPLKGSRPTMDRAPSRTLRRRKL
TRNRFTIDTDLVLHAGDQQQPQAGVTDLWVEEQFDLARYGEVETDAMGGLVKETDILSDD
DEFCNSVRGGGSTTSTAPDLEGSLESLGLR
Download sequence
Identical sequences ENSGMOP00000016837 ENSGMOP00000016837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]