SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016917 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016917
Domain Number 1 Region: 259-562
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.57e-43
Family Galactose oxidase, central domain 0.016
Further Details:      
 
Domain Number 2 Region: 707-842
Classification Level Classification E-value
Superfamily C-type lectin-like 6.24e-24
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 3 Region: 49-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 985-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000016917
Domain Number - Region: 908-934
Classification Level Classification E-value
Superfamily Plexin repeat 0.00371
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016917   Gene: ENSGMOG00000015734   Transcript: ENSGMOT00000017338
Sequence length 1350
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1382:67237:262013:1 gene:ENSGMOG00000015734 transcript:ENSGMOT00000017338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLLVVYILSFCVLLCEASPAKQCDKSCLSGKCINGSCVCDRGWVGDQCQHCQGRFKLTE
PSGYLTDGPINYKFKTKCTWLIEGYPNSVLRLRFNHFATECSWDHMYVYDGDSVYASLVA
VFSGLIVPEVRGNETVPEVETTSGYALLYFFSDAAYNLTGFEIFYSINSCPNNCSGHGKC
TTGNSISSRVYCECDKYWKGEACDIPYCRNNCGSPDRGYCDLTGEKLCVCNDSWQGPDCS
LTVPSTESFWMMPSVKPFGTSLARASHQAVVQDKVMWVVGGYTFNYSSFQMVLSYNLESG
VWNTVPINSGPLPRYGHSVAACQGDIYMFGGRLETGLGNVTDELWVFSVASRTWQRRTLV
LAPTAPAQIYAVEGHSAHCVTMEGGEVVMVVLFGYSPIYSYVSSVQEYNIRSNTWSLPET
RGAVAQGAYGHSSTLDPGTSSVFVHGGYKTLPANKYGLVDELYRYEVNTRTWFILKESGY
PRYFHSAVLVGGTLMVFGGNTHNDTSLSNGAKCFSADFLAYDIACDSWSRLPKPDLHRDL
PRFGHTAVVSNGSMYVFGGFSGVLRNDLLVYRPPSCQAFQTPDTCQGAGPGLRCIWGQGR
CDPWEPRMAPGSLSRAAFCPAKAASVDERCYRFSDCASCSANSNGCQWCDDKRCISAASN
CTSGVQNFTRCPVRTEQVCSKLANCKGCSLNPSCQWDQNQSECHALPAQQCTEGWSQVGD
TCLRLNSSRETYDNAQHYCKNLHGNIASLTTGKQVDFVLQELRTLQLQDKRLSPWVGLRK
INVSYWGWEDMSPFTNSSLRWLPGEPNDSGFCAYLEEPLLWGLRANPCTAKTEGLICEKD
VGNPSQSTRPPCKKPCALHATCGNCTSHGMECMWCGSRQRCVDSSAYVISFPYGQCLEWQ
TTECLAQNCSGLRTCGQCLEQPECGWCGDPSSTGRGLCMEGSYRGPMKRPAKQGQQAQPR
DISLEPAVCPRDKGYEWAFISCPACQCNGHSTCVNGSVCEQCRNLTTGPNCQTCMPGYHG
DPTNGGKCQACKCNGHASVCQVLTGKCFCTTKGIKGEQCQLCDSENRYLGNPLRGTCYYN
LLIDYQFTFSLIQEDDHHYTAINFMASPEQANKNLDMSINASNNFNLNITWSVGSTAGTI
SGEEVHIVSKNNIKEFRESFSCEKYTFRTNPNITFYVYVSNFSWPIKIQIAFSQHNSIMD
LVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRREQLMRERQQMASRPFASVAVALGMG
AEHTELVQPLIDSMPKPIALEPCFGNKAAVLSIFVRLPRGSGGIPPGQSGVTVASALIDI
SQVKTSDFKDKTLGLKSRKAHPPAHQGTCV
Download sequence
Identical sequences ENSGMOP00000016917 ENSGMOP00000016917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]