SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016939 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000016939
Domain Number 1 Region: 246-518
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.77e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000175
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-26
Family SH2 domain 0.0000099
Further Details:      
 
Domain Number 3 Region: 94-212
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-25
Family SH2 domain 0.0000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016939   Gene: ENSGMOG00000015780   Transcript: ENSGMOT00000017362
Sequence length 581
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1963:650627:667097:1 gene:ENSGMOG00000015780 transcript:ENSGMOT00000017362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRGVTGLEAEALLKSRGIHGSFLARPSKKNVGDFSLSVRVQDDVTHIRIQNTGDY
YDLYGGEKFATLSELVDYYTNDSGTLQDRDGQIIEIKYPLNSSDPTTERWYHGHLSGPNA
EKMLGKREEPGTYLVRGSLSKPGDFVLSVLTSEKTKKGDRRVTHIKILCQSERYTVGDTT
FYDSLTDLVEHYKKVGIEEISGHWVHLKQPFYTTRVNAADIDTRVRLLDQMAKNPEENPG
EKSKAGFWEEFDALQKLEAKVKKSREEGQRPENKSKNRYKNILPFNDTRVVLETADPTVV
GSDYINANYVRDTLRPDNDKVFIATQGCLLTTVNDFWQMVWQEKTRVIVMTTREVEKGRN
KCVPYWPAVDAYKEVGAYVVTCLSETDASDYKVRVLEMAPLNESKKTRIWHYQYLSWPDH
GVPQEPGGVLSFLAQVNAKQEMFPDAGPMVIHCSAGIGRTGTFMVIDMILHSIDIQGVDC
DIDIQKCIQMVREQRSGMVQTEAQYKFIYLAVSEHIQAFNAQSKASMETETEYGNLQLMK
HPTASRKVSKNKEEVYENTKGKKDVKKQKSEEKKSGSVRKK
Download sequence
Identical sequences ENSGMOP00000016939 ENSGMOP00000016939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]