SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017266 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017266
Domain Number 1 Region: 255-342
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.34e-17
Family PA3566-like 0.013
Further Details:      
 
Domain Number 2 Region: 32-98
Classification Level Classification E-value
Superfamily EF-hand 0.00000000325
Family Calbindin D9K 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017266   Gene: ENSGMOG00000016094   Transcript: ENSGMOT00000017695
Sequence length 358
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1269:1324163:1344069:1 gene:ENSGMOG00000016094 transcript:ENSGMOT00000017695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFACTEMITMCLQSAKHEHKRKQEQEKIQNQGIAIFQDIFRRADKNDDGKLSLEEFQSYF
GDAILSQMQELYHAIDRQQTDNLDTDKLSEYFTPHLGEYVNVLSALEKLNVAILKAMDKT
KEEYQGSSVVGQFVTRFLLRETSTQLQSLQSSLDCAVGAVDEESCPVRTSPAKPQALPLQ
RALKRPGRRLQKNMCLSPTDPYSGMLTTGSGVSVEPDNHWSSQINQLEDLIDKLECESPH
LEPLKEDTLAGTYKSNILLVQRQMSVKERDVEEFQQTLKIYTDATSAQPDNLHMSVQNLP
DRSCFIMYEFWQDRLSWMSYLQSSISKTFQRCIIDSLEQPEMVSTMLLPASWWIMNNN
Download sequence
Identical sequences ENSGMOP00000017266 ENSGMOP00000017266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]