SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017286 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017286
Domain Number 1 Region: 239-291
Classification Level Classification E-value
Superfamily EF-hand 0.000000317
Family Eps15 homology domain (EH domain) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017286   Gene: ENSGMOG00000016084   Transcript: ENSGMOT00000017715
Sequence length 1202
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4560:57909:102654:1 gene:ENSGMOG00000016084 transcript:ENSGMOT00000017715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRPGSGGGGXXXXXXXXXXXXXXXXXFMYPVGGGMRPTQXXXXXXXXXXXFPMVQVMQ
PNMQGMVGMNYGGQMPHGAMPMQGGMQMGMQAPGMQFMGQAQFMGMRAPGHQYTADMQKQ
MAEEHQKRLGQQQRMLEEDRKRRQFEEQKQKLRLLSSVKPKEKSRDDALEAIKGNLDGFS
RDAKMHPTPSAQTKKPAGVGGYPQQEHIQPVVPGWLYNDSLIPELFKKVLEFTMTPAGVD
TNKLYPILMSSGLPREALGQIWAAANRTTPGMLTKEELYSVLALIGVAQSGLPAMNVDIL
SQFASPPVPNLPALAIAMAPGMPQHQQPMMAPPPVSMATAAPAQALPNPGFLASFPPVQQ
AAKTDDDDFQDFQEAPKPGGGDTSFADFKGESGSSFPAAGATQHPNSSPPMLTPVSGTSS
SSSSDKYAVFKQLSVEQPVEAPPPPSDSGDKYSVFRQLEQPADKKTAGDGFADFKSVSAD
DGFTDFKTSDSVSPLDPPDQAKIFQPPFPPFPTSHSLQQLPPQQPAPPPQPQAPGAPLSQ
PNKALHMADLDLFSPLGPSAPAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEGGHAYDDARDAFCGLRGGGDTSADDFADFQSSKFCTALGAAERSLG
GDKMAAFKQTKEDCASVKSLDLPSLGGSSGPEDSEDALSVQLDMKLSDMGGDLKHVMSDS
SLDLPGLAAHQPPAAEGDDMKFDPFGTSTGSVASYDWSDREEGVSVEARKAPGSDGSALA
PPYGSGLTFGSTENLPDTTTTTAASSTFPPKDDASSSEGKFEAPEPSGDHDDDFGDFAST
VSDKSTAGVDVGPEEPQGEASDEFGAFQGDKPKFGKSDFLKASSQTKVKSSEEMIKNELA
TFDLCVQGSHKRSHSLGEKEIGRCPPSPAPEQPFRDRSSTLSEKPALPVIRDKYKDLTGE
VEESERYAYEWQRCLESALEVITKANNTLNGISSSSVCTEVIQSAQGMDYLMGVVEVYRV
TRRVELGIKATAVCCEKLQQLLKDVSRVWNNLVGFMSLANLVXXXXXXXXXXXXXXXXXX
NAKEIACGVCLLNVDSRSKAFNAETDNFKLLYGGHQYHASCANFWINCVEPKPPGLVLPD
LL
Download sequence
Identical sequences ENSGMOP00000017286 ENSGMOP00000017286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]