SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017357 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017357
Domain Number 1 Region: 194-578
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-142
Family Myotubularin-like phosphatases 0.00000000000541
Further Details:      
 
Domain Number 2 Region: 69-191
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-38
Family GRAM domain 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017357   Gene: ENSGMOG00000016163   Transcript: ENSGMOT00000017787
Sequence length 637
Comment pep:novel genescaffold:gadMor1:GeneScaffold_150:39688:53774:1 gene:ENSGMOG00000016163 transcript:ENSGMOT00000017787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSGSMDSLGSKRSSSRQASVDSLSSTSTSRSDRSAQTKPPSAMSSDSVSTSAELSPEL
KIPNECKEEPQLLPGETVVDVAKEVMYICPFRGPLRGTVNVTNYRLFFRCMDQEPVFVLD
LPLGVVSRVEKIGGASSRGDVSYGLVCKDMRNLRFAHKQSEDALKKSIFEVLMKYAFPVS
NGLPIFAFEYGQVFPENGWKVYDAIAEYKRQGIPNESWRVTKANDHYELCDTYPSSLAVP
VNIPDEDIRRVAAFRAKGRIPVLSWIHPESQATVTRCSQPMVGVNGKRSKEDEKYLQAIM
DANAQSHKLFIFDARPSVNAAANKMKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLK
EVVYPNIEEPHWLSNLESTHWLEHIKLIMAGALRIADKVESGKTSVVVHCSDGWDRTAQL
TSLSMLMLDGFYRTTRGFQVLXXXXXXXXXXXXXXRIGHGDKNHTDADRSPVFVQFIDCV
WQMTRQFPAAFEFNENFLVTMLDHLYSGLFGTFLCNSEQQRVKEELPKRSMSLWSFINSQ
LEDFSNPLYVNYSNHVLFPVVSLRHLELWVGYYVRWNPRMRPQEPVHQRYKELLARRAEL
QRRVEELQREVTNRSASSSSERAGSPTRSITPVQTFV
Download sequence
Identical sequences ENSGMOP00000017357 ENSGMOP00000017357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]