SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017483 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017483
Domain Number 1 Region: 414-470,508-632
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000173
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 2 Region: 601-724
Classification Level Classification E-value
Superfamily EF-hand 0.000001
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017483   Gene: ENSGMOG00000016286   Transcript: ENSGMOT00000017913
Sequence length 902
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3550:73493:80902:-1 gene:ENSGMOG00000016286 transcript:ENSGMOT00000017913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTRVRSQQSQTGRNPAGRLPHRLDSKLEIEMENIQHQDLGLGGIIGAPSPPSRQAWSR
DNPGFEPEEEIMEANWPPASPGRRSVSTASSSSCSSGVGSFTGVGGSGHNQRGGLYPSSA
ADTQRKDKHEHRSCMKQILQKIRILWGTDLMEDSDSSRERYLRNLLREMLTYFSFLIITC
ILTYGMVSTNMYYYTKVMSQLFLDTPLSTGNHATFRSLSTMEDFWKFTEGPFLNGMYWEV
WYNNKSLPDNQSLIYYENLLLGVPRLRQVKVHNQSCIIHRDLRKEVQECFNIYTPSNEDT
NPFGPNNGTAWMHTDEGRLNGSGYWGQVSTYGGGGYYQDLSRTREESALQLALLKDNLWL
DRGTRAVFLDFSVYNGNINLFCIARLLVEFPATGGVVTSWQFQTVRLIRYTSSWDYFVGV
CEVAFCIFILYYVVEEVLEIRIHRLHYFKNLWNCMDVLMIMLSVVAIIMNITRTSMVSNL
LGGLIENHDAHPSFRSLADLQVQFNHVAAVIVFFSWVKLFKFINVNKTMSQLSSTMSRCA
KDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSSFKNSIFTQFRIILGDFEFSEIEETNP
ILGPVYFTTFIFFIFFILMNMFLAIINDTYSEVKADMSQQRTEMEMTDLIKKGCNKALMR
LRLKKTAVDDISDSLRQAGGKMNFDELRQDLKGKGHTDAEIQAIFAKYDHDGDQQLTEHE
HQQMRDDLEKEREDLDIEPNSLARPTSGRSFPRTQEDSEEDDDEDSGHSSRRRGSSSGGV
AYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKTKRKDVLGKLLDGVMEDERM
GRDSEVHREQMERLVREELERWESNDTVSQVGHPQTVTPRPRPPSSLSLDGAEAAANGSG
HI
Download sequence
Identical sequences ENSGMOP00000017483 ENSGMOP00000017483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]