SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017510 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017510
Domain Number 1 Region: 447-529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000245
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 2 Region: 366-484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000176
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017510
Domain Number - Region: 21-163
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000301
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number - Region: 256-371
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017510   Gene: ENSGMOG00000016310   Transcript: ENSGMOT00000017942
Sequence length 695
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4445:5807:60923:1 gene:ENSGMOG00000016310 transcript:ENSGMOT00000017942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVTMDANNIMPILKKKLAFLSGGKDRRSGLILTIPLCSDQTNLEELSTTLHYLLSIPC
KARGFTVIVDGRKSQWNIVKTVVLMLQNVIPAEVSLVCVVKPDEFWDKKVTHFCFWKEKD
RLGFEVILVSANKLTRYIEPCQLTDEFGGSLEYDHIDWLNKRLVFEKFTTESTSLLDELS
VINDGXXXXXXXXXXXXXXXXXXXHELLSELQQRRFNGSEGGGAPWCPMEEELLAQPQVL
RLLDSLREQYTRYQEARRLRSKRSQLEEVHAKVTQVVQWLEGPGCDQLKTSGAIGDSLRE
SQDLQHQHELIESQHSEWFAVYVELNQQIAALLSGGEEEEQEELRLLQQQLSDVCYRQAN
QLEHRQTLLQSAQSFHGSAHELSQQLDGLLGMLCADVVPADGASIQQSLKQLEESLKAVE
KGQALLEQVSSQPPLEVEDPPPVQTNDNVHHIHSVLEDMQLRKQRCEDMVDVRRLKMLQM
VQLFKCEEDSSQAVEWLGELLEALLKTHLRLGDDAQDTSALIDKHTKFIDVAQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEQFFGTPGETASSAEAIRERLLLVEEQ
RGLRLAEEGGLNREGQEICGRVQLEAGLDVIGEEA
Download sequence
Identical sequences ENSGMOP00000017510 ENSGMOP00000017510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]