SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017519 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017519
Domain Number 1 Region: 1097-1446
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-89
Family Hect, E3 ligase catalytic domain 0.0000000817
Further Details:      
 
Domain Number 2 Region: 694-731
Classification Level Classification E-value
Superfamily WW domain 0.0000000000236
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 867-906
Classification Level Classification E-value
Superfamily WW domain 0.000000000167
Family WW domain 0.0014
Further Details:      
 
Domain Number 4 Region: 159-258
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000245
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017519   Gene: ENSGMOG00000016284   Transcript: ENSGMOT00000017951
Sequence length 1452
Comment pep:novel genescaffold:gadMor1:GeneScaffold_203:2227:51984:1 gene:ENSGMOG00000016284 transcript:ENSGMOT00000017951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIMLTHLCSIKPRSTSDTDLVTSYCRSTLTTSSSHYTIGQPQDIHVIWDIKEEVDAGDWI
GMYLIDEPLSENFLDYKNRGVNGSKKGQIVWKIEATSYLPESGGPLCFRYYHGGTGALRA
TTPTLTVTTPAAPVKPVVSPEAHHGLGGRRLINFSLSDVQALGLKKGMFFNPDPYLKLSV
QPGKHSAFPSLPHHGQDKRSAISCNTVNPQWSRERFSFLSLPTDVLEIEVKDKFAKSRPI
IRRFLGKLCVPVQRLLEKNAIGDRRVSYPLGRRLPTEQVSGQLQFRFELTTCIYPDDEEV
SQALESVRQHGETWVEAEDPSDVEDADTLSLGDDMPELPLDEAPPGPELSATPPALDLRV
SGEAAPLGAKEESTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDDLVEERGAMPEKESRAERKRTGGPTGGLQPCTSCTCRHCSSICRGPDPPRRRARPC
SLPVSELETVIAASCGQPETPRSHYIRIHHLLHSLPSAQNREPSQEDEDEEEEEEDEGHQ
DATCVSLELKPATSCHSRSTSCRSTSCYSTSCYSTSCYSHSGYDSRGRFCSQRLSSVDST
RRSGSTVFSSQDDDDEENSAFERVPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPVGPLVSPPAALRPGWDLDHFSTDHTLPPNWEARIDSHGRVFYVDHV
NRTTMWQRPSQPPQCSQGLPRSGSTQQMEQLNRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLPVNHQSISLLLQSPAVKFITHPEFFTVLHANYGAYRTFANSSCVK
HMILKVRRDARNFERYQHNRDLVVFLNTFADPRLELPRGWEMKTDMQGKSFFVDHNSRAT
TFIDPRVSLRCGRPPGPFSHRPHLQRLRSYSAGEASDVSRRPGSSLRARPRDSLVPAARS
QQDAFSLAYNDKIVAFLWQPNVFDMLEERQASLARNPALREKIHYIRTEGSQALEKLSCD
ADLVILLSLFEEEIMSFVAPHALHTSRGFSPRSSPIASPHSSPAGLQRAPAPAPYRRDFE
AKLRNFSRKLEAKGYGQGPGKMRLLVRRDHLLEGTFDQVMAFSRKELQKNKLYVSFLGEE
GLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTLQISPMSALVENHLQWILGLGLIH
HYLLDVFFTRPFYKALLRLATDLSDLEYLDEEFHQSLQWMKDNTITDILDLTFTVNEEVF
GQVTERELKSGGSHIQVTEKNKKDYIERMVRWRAERGVGQQNEALVRGFYEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHDSHVVMRWFWAAVECFNNEQRLRLLQFV
TGTSSVPYEGFSSLRGSSGLRRFCIEKWGKVTSLPRAHTCFNRLDLPPYPSFTTLHDKLL
TAVEETSTFGLE
Download sequence
Identical sequences ENSGMOP00000017519 ENSGMOP00000017519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]