SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017523 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017523
Domain Number 1 Region: 136-260
Classification Level Classification E-value
Superfamily vWA-like 6.3e-41
Family Integrin A (or I) domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 357-466
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-21
Family Integrin domains 0.00089
Further Details:      
 
Domain Number 3 Region: 311-378
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000378
Family Integrin A (or I) domain 0.00063
Further Details:      
 
Domain Number 4 Region: 636-724
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000458
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 5 Region: 25-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000732
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 593-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Integrin beta EGF-like domains 0.0022
Further Details:      
 
Domain Number 7 Region: 552-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Integrin beta EGF-like domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017523   Gene: ENSGMOG00000016332   Transcript: ENSGMOT00000017955
Sequence length 796
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2070:4293:22661:1 gene:ENSGMOG00000016332 transcript:ENSGMOT00000017955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRLLSVGAVLMLFGGSWAQQEGSECIKANAQSCGECIQVAEKCGWCTDENFLRDGESK
TVRCDDIGSLSAKKCVKIENPRGNINININKDVTNRKKDQADKLKPEQITQIKPQKLTLN
LRSGEPLTFNLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTHLMREMQEITSDFRI
GFGSFVEKTVMPYISTTPARLANPCIGNYNCTSPFSYKNVLSLTNDGNQFNNLVSQQQIS
GNLDSPEGGFDAIMQVAVCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSS
NSSNVIKLIIDSYNSLSSEVILENSRVPEGVTISYKSVCKNGVTGTGEGGRKCSNISIGD
EVSFQISVESTKCPSHNSETIKIKPLGFTEEVEVVLNFICECECSKGGVPNSKDCHNGNG
TLECGACKCNAGRIGGKCECSKDELRTEDLDANCRRDNGTDICSNNGECVCGTCECKTRE
NPAEIYNGKYCECDNFNCDRSGNKLCGGHGQCECRMCVCEANYTGSACDCSLDTSTCLAK
NGQICNGRGTCECGECKCTNPKFQGSTCEICPTCPGVCPEHKDCVQCRAFGGEGDKLACE
QSCGYLTLVKVARRDDLPQPTDQSFPLTHCKERDANDCWFYYTFAVRNDTPEAYVVEELE
CPAGPDIIPIVVGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPI
YKSAVTTVVNPKYEGK
Download sequence
Identical sequences ENSGMOP00000017523 ENSGMOP00000017523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]