SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017554 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017554
Domain Number 1 Region: 754-830
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000126
Family Pleckstrin-homology domain (PH domain) 0.0000325
Further Details:      
 
Domain Number 2 Region: 264-401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000078
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 3 Region: 20-175
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000011
Family CRAL/TRIO domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017554
Domain Number - Region: 593-631
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00484
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017554   Gene: ENSGMOG00000016351   Transcript: ENSGMOT00000017986
Sequence length 831
Comment pep:novel genescaffold:gadMor1:GeneScaffold_554:86:60154:-1 gene:ENSGMOG00000016351 transcript:ENSGMOT00000017986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSLSDEIMQQEIRPLLAMDIIEQLHRQFAMLSGGRGKDGAPIITFPEYTDFTDLPDEDF
LNVVTYLTSIPSLDAASIGFVIIIDRRKDKWTSVKASLTRIAGAFPGNLQLVLVLRPSRF
LQRTIADIGIKMHRDDFKMKVPIVMLNSLSDLHGYVDKCQLTCELGGSLDYCHSQWIHHR
TAIENFAVTVKTTAKMLQKFGTDLAETELPNDVPCTKELLTAHTEKHTTLKLKLALKQGT
TLLGCIKEQSAKSESHKLNPDEIENQTTVERLLAQLDETENAFEQFWSKHHLKLEQCLQL
RHFEQDYREVKLSLDSLLEALNGLTDNGDCVARVEYLLKELKSLEEKAKATVEEAHLHAS
HGDQLIQSNHYAVDSIRPKCVELRRVCDDFSNEARKKTDVLSKSLQIHRGIDKVNQWCEA
GVFLLASQAVDKCQLQEGAESGLVDIERFQETANEKQLTELRNIHNQYEMVLSEDIKASV
LKALKRLEDVQEMFEKRHVSLKKLSAKQTRPVQPVAPRPESSPKRPPLKNQSRTPVAPQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYFSELDN
SELSHLIPPSLENKRDVLFGNLPEIYEFHNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMLK
CSKGEGTVELEEALATMLDIIKSVNDSMHQIAITGFEGNLSELGKLLMQGSFNVWTDHKR
GHSKVKDLARFKPMQRHLFLYHKMLLFCKKREETIDGHDKTPSYGFKHTLK
Download sequence
Identical sequences ENSGMOP00000017554 ENSGMOP00000017554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]