SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017608 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017608
Domain Number 1 Region: 40-507
Classification Level Classification E-value
Superfamily Sema domain 2.75e-108
Family Sema domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 1059-1325
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-74
Family Protein kinases, catalytic subunit 0.00000000656
Further Details:      
 
Domain Number 3 Region: 664-748
Classification Level Classification E-value
Superfamily E set domains 0.000000000021
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 
Domain Number 4 Region: 748-841
Classification Level Classification E-value
Superfamily E set domains 0.000000000128
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number 5 Region: 511-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000167
Family Plexin repeat 0.00074
Further Details:      
 
Domain Number 6 Region: 553-629
Classification Level Classification E-value
Superfamily E set domains 0.00000202
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017608   Gene: ENSGMOG00000016372   Transcript: ENSGMOT00000018041
Sequence length 1358
Comment pep:novel genescaffold:gadMor1:GeneScaffold_176:173946:190498:1 gene:ENSGMOG00000016372 transcript:ENSGMOT00000018041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTWVASLLTVCALIQTRAAAGPTSSCPTTPRRLVDFNVNYTLPHFQTANPIQNIQANAY
LREVYIASQNAIEAVDRDLKRIWEVRTGPVGPDDCHTCGPCDAATTPPATPVDTDNKVLL
LDRRAPSPYLYYCGSTRQGVCAFLDISELSPVSHCLFKEQDNTETYCPDCLASPLGTRVS
AVEQGQTTLFFVANSVDEELASRWPRRSLSVLRPLSTEDGFHMAMQGLTVLPPLRASYRV
DYVYTFATAEHVYFLSVQRENPEKSGSPLQTRLGRLPLMNSEAWMYREVVLECRFDPKRR
RRKRRGGEEQHRVVFNGLQAAHYGPVGRELASQLGLKGEEKLLYGAFAEVDERGVPQRNS
AFCIFALAKVNQAIDRGVAACCSKGTEQLSRGLCHFQPCENCPHEXXXXDDSCRNKPTLV
SAPYYRLDLFNRQMHDVLFTTVLVTTKGNDTLGHFGTSDGRILQVVLKLDSVFFANFSLG
GTPVSGVSSVYTEDLLLFVAGNKVFTVSPVGPGCAHFVSCSSCLTAPLFMGCGWCSGSCS
REDECSSPWHRTSCAPVITEFFPKTAPTGAESELTLCGWDFQSPKGPSAITDKTHTVRVG
SETLCTVQAKSTSTKLVCKVRHKKGTPTKALNVTLEVQEATLGGCYSIHGQAQASGFSFV
VPIITEVRPALGPKIGGTMITLTGSHLNSGIGRSVDFGGISCPIQSMTEGSGSVSSVVCI
SKASTGAVPVRFFIDSFLVPTQKKFSYRHDPVITNVYPQCSYRSGSMLRVEGRYFDSVQN
KVVQYKPSLVCEGKVNATHMECRAPALPGEHSDDKTENGEISFRMDGARLILNKTFDYHP
DAAPIPFENEERVLYLREMEVSMHHINLNAVDQCMNITMTIGGVRCKVQVLTNELTCRIP
KGLVIPAEGLPVQVCVNGKVTDIGNVVLRDDHSPTIIAGIVMGILAAIVLGAALALFGMT
RLRKTKQDKVEFRLSRMSSRIHTGNGETSPTGDYRRTDLSIQTSGQGGLFFQGPWYASGY
DPSVSLSLIANLSMGSLRSDLLEEVKDVLIPAEMLRVVESQIIGKGHFGTVYHGYLMDHK
DQEIHCAVKSLNRISDVEEVDLFLREGIIMKGFHNTNILSLLGIMLPKEGLPLVVLPYMK
HGDLRHFIRSEKRNPTVKDLVGFGLQVAKGMEYLSQKKFVHRDLAARNCMLDENFTVKVA
DFGMARDIFDKEYYSIQDHKKAKLPVKWMAIESLQTQKFTTKSDVWSFGVLLWELLTRGA
TPYPDVDPYDITHYLLKGRRLAQPQFCPDALFSIMVACWEPEPESRPPFQALVQIVQEIM
ECLEGEHYISLKVTYVNLDAPKPYPTRADSADEAEDSD
Download sequence
Identical sequences ENSGMOP00000017608 ENSGMOP00000017608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]