SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017670 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017670
Domain Number 1 Region: 123-205
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.28e-40
Family variant PHD-like domain 0.0000782
Further Details:      
 
Domain Number 2 Region: 195-333
Classification Level Classification E-value
Superfamily EF-hand 0.000000000802
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017670   Gene: ENSGMOG00000016464   Transcript: ENSGMOT00000018105
Sequence length 397
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3690:2841:51015:-1 gene:ENSGMOG00000016464 transcript:ENSGMOT00000018105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLMSKKQQVEKVQKCNAVVNAFQQGVKVTAPPAIHDQADDNVGGYRRATRGEGEEGGE
EEADAAPPPTRDGCNVNKEAWSRMRDGKGVEPEDMQKSHQLTPPAFVRPKRDANDDQALE
VELGKRDQPSNDEMCDVCEVWTADDLYPCRICTRVFHDGCLRELGYLRAEALQEMRDSAH
TITGWSCYYCDNVNLLLTEEEMYSLVETFKQCKIIPESCLVSDELLQYRHFMSKQQYEKD
LTDEQEEEVLGQFAAMDPEKKGHIEWSDFLYFESMSVLRKLRTENSMVRLLSSKERDRAR
TLFLGLDLDKDGLITGGESRQAQPSWFHKLNKDSQSCNVSISHGAMCESSPASSASERPP
SCVSSRSVTWADFLKESAIYIIAARPNSSAMHIRLPL
Download sequence
Identical sequences ENSGMOP00000017670 ENSGMOP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]