SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017719 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017719
Domain Number 1 Region: 37-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000116
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017719   Gene: ENSGMOG00000016516   Transcript: ENSGMOT00000018154
Sequence length 186
Comment pep:novel contig::contig333213:510:1163:1 gene:ENSGMOG00000016516 transcript:ENSGMOT00000018154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVLEGDDLSMVIHADTCRSISLASYNTIKKITILTYQPGTEPNTMERAEFSKTTFSLQIK
NLRLNESGLYEAVVISATQDIVAEYHVTVQERVSPVVLNVSSVSLSPESCKVTVTCSTQS
SSLNSTFTCTPRTCSEDGEDPAEVVTSDGSLQIYLSNGLNAVCNHSNKVSWSKATMEIKP
LCFEDD
Download sequence
Identical sequences ENSGMOP00000017719 ENSGMOP00000017719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]