SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017803 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017803
Domain Number 1 Region: 25-244
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-48
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 247-369
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000015
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017803   Gene: ENSGMOG00000016543   Transcript: ENSGMOT00000018242
Sequence length 371
Comment pep:novel genescaffold:gadMor1:GeneScaffold_169:327229:329917:-1 gene:ENSGMOG00000016543 transcript:ENSGMOT00000018242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQVTVAPPPPARFPRDRLTTFWQDLDEVKECGVLATLSPREVHRQEAMFEVIGSEASYL
RSLGVAVNHFMASKKLSRTVSPLEHHVLFSNLRHVMSASESFLVALERLLGECVVIPQLG
GLMLQHCPRFRALYVPYLSNMMFQEALVNKLLQENKGFVSALKTLERDPVCQRRSLKSFL
VLPFQRITRLKLLMEHVLTLTEPDADSYLTLIKALVGLHKDQVIMECNEGVRRMKQIEEL
VRLEVLLDFNNLKLLPLVVKGRFLLHDGPLRQLNRVGSDSKISFTDVHLHLFSDLLVISV
QKEQRFGVLDHTSFPGNVRVELVNAGMLALPTDSFLLHLSQNHAGHATALILAARSRSDQ
MAWMKMLSAQS
Download sequence
Identical sequences ENSGMOP00000017803 ENSGMOP00000017803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]