SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017843 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017843
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-36
Family Dual specificity phosphatase-like 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017843   Gene: ENSGMOG00000016629   Transcript: ENSGMOT00000018282
Sequence length 179
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3222:173673:174564:-1 gene:ENSGMOG00000016629 transcript:ENSGMOT00000018282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPARKVEIDLSSPGLAVGELERLLFTGKAICSHADEVWPKLYIGDQHSAENLADLSLQRI
THVLNAAQCRRHAGADLYKGTSITYMGIEARDSCNFDLSPNFQRAACFIDGALGRFVVGR
VLVHCQVGVSRSATLVLAYLMLKQRLTLVEAICAVKNHRGVVPNRGFLRQLIQLDGQLF
Download sequence
Identical sequences ENSGMOP00000017843 ENSGMOP00000017843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]