SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017852 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017852
Domain Number 1 Region: 194-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-52
Family DBL homology domain (DH-domain) 0.000000367
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-37
Family Calponin-homology domain, CH-domain 0.0039
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-35
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 4 Region: 638-767
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-27
Family SH2 domain 0.00061
Further Details:      
 
Domain Number 5 Region: 783-844
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-22
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 6 Region: 595-667
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000494
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017852   Gene: ENSGMOG00000016597   Transcript: ENSGMOT00000018291
Sequence length 846
Comment pep:novel genescaffold:gadMor1:GeneScaffold_543:158526:226688:-1 gene:ENSGMOG00000016597 transcript:ENSGMOT00000018291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAVWLIHCKVLPATHRVTWESAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEI
NLRPQMSQFLCLKNIRTFLAACSDIFAMKKSDLFEAFDLFDVRDFGKVMDALSKLSHKGA
TLQNGIRPFPTEESVEDQDIYNHLEDLIDENGVEDEEDLYDCVYEDEEGGDIYEDLMKTN
VIPPPAFQKHVETDIRSCCLAEIRQTEEKYTETLESIEKYFMSPLAVFLSAVEMEKVFVN
ISELVNLHKSLLVEIQDSVQHKSAQNLYQVFVTYKERLLIYGQYCSHVETAIAALDSICK
DKEDVRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTQNPADKSNLRIA
LDAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQPLRNYGRPKGDGEVRVSSVDKRAK
QDRHIFLFDAAVIVCKRRGDNYEMKEVIDLHHFKITNSPTSEKENRKWSYVFYLTHNQGQ
TGFEFFFKTKELKKKWLDQFSMAISNIHPENGTSNNHEFRMHTFDRITSCNSCHMLLRGV
FNQGYMCSKCGLGAHKECLGRFGGCGKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPK
MLVVRNYFGMPSPTSGHPLTIHAGNIIELLDADIHSPWWQGRILTTKEVGFFPSDAVKPC
PCVPKPVDYSAQPWFAGPMERFQAEAELLNRGNSTYLVRHRSRESTEYAISIKYNNDVKH
IKILAKDGCFHIAENKRFRSILELIEYYKHHSLKEGFRSLDTTLQYPHREPENPAAERNP
RQALAPKVMGVAVARYDFSSRDMRELSLQEGDLVTIYTKTGANGWWRGEVNGRVGWFPSS
YVEEGE
Download sequence
Identical sequences ENSGMOP00000017852 ENSGMOP00000017852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]