SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017890 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017890
Domain Number 1 Region: 850-1081
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-59
Family Protein kinases, catalytic subunit 0.0000102
Further Details:      
 
Domain Number 2 Region: 490-794
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-46
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 3 Region: 358-460,496-521
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-18
Family SH2 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 245-346
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000811
Family Third domain of FERM 0.0072
Further Details:      
 
Domain Number 5 Region: 113-232
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000254
Family Second domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017890   Gene: ENSGMOG00000016634   Transcript: ENSGMOT00000018329
Sequence length 1090
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3571:724711:754677:-1 gene:ENSGMOG00000016634 transcript:ENSGMOT00000018329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLTVVLYHRGRGRTRDGDKSGADAELTYPPGSYVGQELCVDAAKACGITPMHLSLFGLMR
ESDHMWLPPNHVLNLEPSANERVLFRIRYYFPGWYNNGSSSCAHRFGTAKGTESPVMDDC
TMTYLFCQWRSDFVNGCVDVPLSQEAQAECLGLAALDMMRLAKEGDQSPVYFYNQTSYKA
YLPRNVRAHIQRYNILTRKRIRRRFSKFIHRFQDCKAAVRDLQLKYLMCLETLLPSLHVE
RFRANEVTIVVTGNKGIQWFREKEAEPGEEVLKTYCDFPEVIDISVKQASKEGSVEGRIV
SLSTQDKPSMXXDLEFHSLQEALSFVSLVDGYYRLVANAHHYLCKEVAPPRLLEAIRSYC
HGPVSVDFSTHKLRCLGNHQGMFILRSSPRDYNTYFLSFVVNDSGVQYKHCQIMKTEAGE
FLLQGASRSFGSLEDLLHQYQKEVLRTEGFTFQFTKCLPPTIKDKSNLLVCRSPQGVEVP
VTPWLHQHHINQMVFHKIRKEDLTLKKSLGQGTFTKIFCGVRKELRDYGEVHETEVLIKV
LDKAHRNYSESFFEAASLMSQLSHKYLLLNYGVCVCREENMMVQEYSKLGSLDTYLMTKK
ACVNIPWKLEVAKQLAWVLHFLENKNLIHGNVCAKNVLLIREGDCKMGSLPFIKLSDPGI
SITVLPRDVLMERIPWVPPECIENARNLSQAADKWSFGTTLWEICNQGEKPLGNMDISKX
XXXXXXXXXXXVPKWTELANLINSCMDYEPSHRPSFRAIIRDLNSLFTPDYELLVESDML
PNPTRVFGLSLTLDHREPTQFMERHLIYIKQLGKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEREIDILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLVK
YRERFNSQKLLHYASQICKGMDYLATKRYIHRDLATRNILVESEMRVKIGDFGLTKVLPQ
GKEYYTVTDPGESPIFWYAIESLTDSKFSVASDVWSFGVVLYELFTYSEKKCSPPTVLMD
EMGNDKQGQMIVYHLIDLLQKQGYRLPAPDNCPSEIQKIMADCWHGDPALRPTFRELAHS
VDVTRDSQVG
Download sequence
Identical sequences ENSGMOP00000017890 ENSGMOP00000017890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]