SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017969 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017969
Domain Number 1 Region: 717-857
Classification Level Classification E-value
Superfamily PH domain-like 7.11e-49
Family Phosphotyrosine-binding domain (PTB) 0.0000036
Further Details:      
 
Domain Number 2 Region: 583-708
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-25
Family SH2 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017969   Gene: ENSGMOG00000016701   Transcript: ENSGMOT00000018410
Sequence length 861
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2996:14712:31197:1 gene:ENSGMOG00000016701 transcript:ENSGMOT00000018410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLPLAVSDRTPPPPEVMTEISAPGGVDGGGSQTGERETDILDDEEDADTILPAFVNPSSA
AVGRLSSDDRSPGARPDVCISVAFSTLPWTQQVHPGGETPSERGTAPYTPPRGTSSREAV
LRVALGDTSTSELSQEEELSLSTDMEESIEQLNQLILDLDPTFVPVPTRSTPLSRSASLH
SNGLSPGGQGHKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSLYKMDSVDFRGQNTAVIDSYDVVPS
TPAFPVSPPTPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESGDTCTDREAIFXXXXXXXXXXXXXXXX
XXXXXXXXXGCLTPGPPGLPVARSHTLTQLTPLSHSSPRGGPTGLGAPPELLGEMSNLSS
LPLGNGSLLEHSLLEAMEGLGGLRFGLGLGPDDLGLPPLLPEKRTGSKGGELHSHSPAGS
PAHSDSSLSIPFSSPEPLRGLSRTSSPGYSELSGSRQDTVKFVQDTSKFWYKPDISRDQA
ITLLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQQSKKAGDPSNELVRHFLIECT
QKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLILPDKDPMEELHDSSPQTASNSAA
ELLKQGAACNVWYLGSVELESLTGHQAVQKATSQTLVADPQPTSTVVHFKVSAQGITLTD
NQRKLFFRRHYTVNTVIFCSLDPQARNLLFLSSVRIFGFVARKSQSGTENICHLFAEHDP
EQPASAIVNFVSKVMIGSLKK
Download sequence
Identical sequences ENSGMOP00000017969 ENSGMOP00000017969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]