SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017996 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017996
Domain Number 1 Region: 1264-1441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-44
Family DBL homology domain (DH-domain) 0.0000411
Further Details:      
 
Domain Number 2 Region: 1451-1565
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-36
Family Pleckstrin-homology domain (PH domain) 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017996
Domain Number - Region: 905-1015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 556-714
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0196
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017996   Gene: ENSGMOG00000016704   Transcript: ENSGMOT00000018439
Sequence length 1634
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1646:14692:40789:-1 gene:ENSGMOG00000016704 transcript:ENSGMOT00000018439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSDSLDSCIQSTLSALYPPFSASAPTVLWQLFSVVERQYRGDGLRCLLDFLLPAKRILQT
IQQDTCLRFRGLLLYHEGWPLCIHEKVVLQLAPLHKVRLKQGDFYLQVVPLGHKTAKLVI
KCLSGSGQAIAEIPIAESMYGNVFSAEFLQNVTQGRSLQPLQNCLLTTGTSVYRTAWNNV
VSPLFVSSTADAVSQARCGRGGLRGQLSTCSTSGSTGTLDSHRSSRESLHSQGADSIFTS
EPTTPNRTRMEPGRDHTSGGASVAQTSTHSSETEGLVLENGRGRERGPGSRTLSFSTDLS
NPGPRSRLPRDSVTFESRRLFRKSYMEALQNPMSIGSSSESILEEGLEHGVGPGSRAGTP
GSSPDARATLREHLTRRLGSRSWLSGEDSRPSTPLLYLQRGLRSAERRADRRSKSLERTN
KAAQVVCSLACSGYRNHNFVAQPLWKCDVKRTNQFPLNTIKTHRVDLLLQLPQQGGVTVV
ARQDSHESHLEIAKEPDRLRERPTTSTGTRDDGAGSDCIALHPSGRQSCESWVICGAGPG
GHPVGSTPLPSLLSEVNQELLESGALILPGSRDRSGRIVLQVCTRGRVWAGDSATAKDLT
CLLCYYYSTLRRERREQGLTVLVDSRRQPPSPALLSSLSELQALLPNALDSVLFLVDKEA
AARSERDLHIQNELVTSLKSLLKHIDNTQLTADLEGSFHYDHKHWLTFRQKIEPFARSCS
AAIRSLQESIDRLKTWISPETSQGVSERMEQQRHLMKSVLADARLNSLRLEGGTVLARIR
KEEACQNNNYRDAIDMVNALYNQVDEEVHELVILSNDSQKHLENLLEVCKFEEQTQQVKL
WFSVEGEKQLAPLDSQMLSLTSVKEMRQSLDNFLAESLHQQRLGLAVVRASPGRLPGAAL
LLFKEHLGSVLTRVEGRKTQLDTLTTLYEFYDSANRWMEHCQDYSHQLSMESHGVSLPPA
VLQILRDYHAEASKFSPQNFGPLNQMVLSLDSPGQLQRWNALWHQCQQTKQQLEETLANA
VSADAAATASNPPAVHVSGLEATETHSRNTAGLHGRKGSLPLPTPSPTLALGASKQQSAG
PLPKSPSSSLSSSSHFPFFPGEGEGPLRHSPSPFDDTDSDCTMDSSSVSCCSEPAYPGAA
KHRKQQPLKKIMKKTLSYELTPSREGGHCHGDTSHLHGYTGVYIRGLEVTNSVSAEKKLQ
RPDLTSPVPGRGLSSASSASRPNSRHDGDGKKQSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKAQHIMDEMMATEQDYVRSLHYVIEHYFPEMERPDLPQDLRGKRGTVFGNVEKLSDF
HSRYFLKELESCSHAPLSVSSCFLRHEDQFGMYALYSKNKPQSDTLLFSHGNYFFKNKQL
ELGDKMDLASYLLKPIQRMSKYALLLKDLIKECSPSEEQELSDLRTAEEMVKFQLRHGND
LLAMDAIQGCDVNLKEQGQLRCQDEFIVWCGRRKYLRHVFLFEDLILFSKTRKIEGGYDL
YIYKQSFKTAEIGLTESVGDRGLRFEIWFRRRKSQDTYVLQASSLEVKAVWTAIIGKILW
RQALRNRELRMKEMVSMGIGSKPFMDIKPSDAAISDRAIDYIMKGSDHSFSFKRPHSTIS
NSSTSSSSSQSSSS
Download sequence
Identical sequences ENSGMOP00000017996 ENSGMOP00000017996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]