SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018003 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018003
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Histone-fold 1.69e-21
Family TBP-associated factors, TAFs 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018003   Gene: ENSGMOG00000016768   Transcript: ENSGMOT00000018447
Sequence length 202
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4218:41804:47015:-1 gene:ENSGMOG00000016768 transcript:ENSGMOT00000018447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIITSARALELFLESLLTKACHVTQ
SRNAKTMTTSHLKQCIELEQQFDFLKDLVAAVPDMQGEGEENHTESGAGADKVPRSRGRK
PGSGRKNGGGASSKGKEKKLSGTESEQEDDSEDSETDGDEEDGSQSSTNMASRFHGGTPP
APPTSVPHKEAEDDDDDEDYDS
Download sequence
Identical sequences ENSGMOP00000018003 ENSGMOP00000018003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]