SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018019 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018019
Domain Number 1 Region: 256-362
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-23
Family PDZ domain 0.0000301
Further Details:      
 
Domain Number 2 Region: 425-529
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-20
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 3 Region: 809-873
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-19
Family PDZ domain 0.00068
Further Details:      
 
Domain Number 4 Region: 32-89
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000212
Family Nucleotide and nucleoside kinases 0.0036
Further Details:      
 
Domain Number 5 Region: 162-197
Classification Level Classification E-value
Superfamily WW domain 0.00000000116
Family WW domain 0.0029
Further Details:      
 
Domain Number 6 Region: 935-975
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000158
Family PDZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018019   Gene: ENSGMOG00000016734   Transcript: ENSGMOT00000018463
Sequence length 1236
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4578:110332:168544:1 gene:ENSGMOG00000016734 transcript:ENSGMOT00000018463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNKLNKDLKRYLGLRFQKSSPDHELQQNIRANLYRHAVPCTTRPPRHGEVSGVDYNFLSV
QDFLELDETGTLLEIGTYEGNYYGTPKPPRQPLIGALILGDAGPQPSTPKRTRSYHDMQH
ARVAPDDHDDDDLASEMNNSFTGTRXXXXXXXXEEGIQTEDLESDIELPPGWERIDDPVY
GVYYVDHINRKTQYENPDGGPPAGPPXXXXXXXXXXXXXXXXXXXEWIEEHASVGAPLAN
FNPNHLETYRDPQVRGKPFFTRNPAELKGTFINTKLKKSRRGFGFTVVGGDEPDEFLQIK
SLVLDGPAAVDGKMETGDVIVSVNDTIVLGYTHAQVVKIFQSIPIGSMVDLALCRGYPLP
FDPDDPNTSLVTSVAILDKEPIIVNGGQEAYDSPSGHGGQGGPNNGMRDPRPHSPSGDAA
SNGSHGGYPSDVQSLASSIATQPELITVHMEKGDKGFGFTIADSLTGGGQRVKQIVDYPR
CRGLREGDILMEVNKRNVQNMSHNQVVDLLSKCPRGSEVTMLVQRGXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLSKMLRSLCVAVPDSQEQDIFLWRKDTGFGFRILGGNE
AGEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQNKQTNITQKAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILSV
NACSITNKSHSDIVNLIKEAGNTVSLRIIPGDESSNASLLTNAEKIATITTTHNPDRRHP
GCVLFDQPELMCFFVLLLQKLKVRSATASTITGSVGDEILEINGESTKNMKHARAIELIK
NGGRWARLVLKRGDGSVPEYDGSNDGYPPTPGAQDSAEVRHLPPKSRYHTSLESSYPPDL
HTPSRQEEAVRGRDRDRAGADRMDYEGRQFPPHHHHTWNNNNHSKSTPRQPSPDNQSSGG
GKKGRGRKVKKSESESGISKLLKTLRKDSSGKKAAEKERGRERATSHSSSSTLDPRTAQP
QRRGSLDRSPTRKRNSSPDRRRAKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXATGHNNNTWARARANQLPEPKRRLYKESPKDLSI
Download sequence
Identical sequences ENSGMOP00000018019 ENSGMOP00000018019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]