SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018032 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018032
Domain Number 1 Region: 63-116
Classification Level Classification E-value
Superfamily EF-hand 0.0000586
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018032   Gene: ENSGMOG00000016781   Transcript: ENSGMOT00000018476
Sequence length 365
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1646:78175:82774:-1 gene:ENSGMOG00000016781 transcript:ENSGMOT00000018476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLAHGDLREGPFVEHPCPLEVVLPPEKGEGCESYLQYLRSAEGEREVLLQDTSKAPGKKR
ISLNDLECKVSLEDSNRQEWFLTLYDFDNSGKVHKEDMSSLMHTIYDVVDASVNHSCQNK
SKTLRVKLTVSPENRSHRRDNGTASSEREQGRCHQEESRYADKRLSDNIEPLPPDGQHYC
VDENTERRNHYLDLAGIENYTSRFETTPPPPPQKAPVRRPQSQSCSRSQEPVAHAAHHRR
SQVIGDSYNPVEPRGKGAHLLRSPKGAYKGDGGDGSSRPSKCHGTHPSTLHGGQDVYHLP
HQATPTSQHPLQYSHSKRLRQDKRHPNQDPSAQPQHHPPMPSVLPALASPPVSPRVVVPL
VQRHE
Download sequence
Identical sequences ENSGMOP00000018032 ENSGMOP00000018032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]