SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018044 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018044
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-16
Family Variant RING domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018044   Gene: ENSGMOG00000016812   Transcript: ENSGMOT00000018489
Sequence length 113
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2849:66992:68280:1 gene:ENSGMOG00000016812 transcript:ENSGMOT00000018489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEPFCRICHEGGSSGELVSPCECSGTLAMVHRACLERWLTSSNSSHCELCRYQFSLERLP
KPFTEWLRSPSMQHQRRTLFGDVVCFLFITPLATLSGWLCVQGALDLHHTNGY
Download sequence
Identical sequences ENSGMOP00000018044 ENSGMOP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]