SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018073 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018073
Domain Number 1 Region: 3-489
Classification Level Classification E-value
Superfamily Sema domain 1.83e-166
Family Sema domain 0.0000000000749
Further Details:      
 
Domain Number 2 Region: 485-537
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000061
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018073
Domain Number - Region: 590-633
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00119
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018073   Gene: ENSGMOG00000016820   Transcript: ENSGMOT00000018519
Sequence length 636
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2601:8:56801:-1 gene:ENSGMOG00000016820 transcript:ENSGMOT00000018519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELVSTNRSSVFSGHQGDLALTAVFLDEYHDRLFLGGKDVLYSLTLGPAATESKEIHWPPL
PGNRDDCIQRGKEPQTDCANFVRLLKPFNRTHLLACGTGAFQPICSYIHVGYRGEXXXHV
FTMDPTNVENGRGKVPHDPSLPFASTFNGGELYAGLTADFLGRDSVIFRSMGGRSTMRTE
TDQKLLHDPRFIAAHVVPDSDDRDDDKVYFFFTEKAMESGDREGAIHTRVGRVCANDVGG
QRVLVNKWSTFIKARLVCSVPGPHGIDTHFNQLEDIFVLRTKDERNPDVYAIFSTISNVF
QGYAVCVYSMADIREAFNGPFAHKEGPDFQWKVYEGRVPYPRPGVCPSKITNQPGREFSS
TKDLPDAVLQFTRGHPLMWRPVFPAQRRPVLVRANTPYKLTQIVVDRVEAEDSQYDVMFI
GTDVGTVLKVISLRNGNSLESEEVTLEELQVFKVPTPVTSMEISAKRQALYVGSPLGVAQ
VKLHRCETYGKACAECCLARDPYCAWDGLTCTRFLSSGKRRFRRQDVRYGNPVLQCVDQN
LSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKLDDRVMATEQGL
LFRRVFRQDQGVYVCRSREHGFTQTLARLTLQVLQG
Download sequence
Identical sequences ENSGMOP00000018073 ENSGMOP00000018073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]