SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018121 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018121
Domain Number 1 Region: 1126-1348
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-47
Family DBL homology domain (DH-domain) 0.0000000669
Further Details:      
 
Domain Number 2 Region: 1348-1488
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-31
Family Pleckstrin-homology domain (PH domain) 0.000000283
Further Details:      
 
Domain Number 3 Region: 187-287
Classification Level Classification E-value
Superfamily EF-hand 1.71e-28
Family Eps15 homology domain (EH domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 1502-1622
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-26
Family PLC-like (P variant) 0.0088
Further Details:      
 
Domain Number 5 Region: 1054-1126
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-25
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 6 Region: 623-701
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 7 Region: 18-107
Classification Level Classification E-value
Superfamily EF-hand 5.39e-20
Family Eps15 homology domain (EH domain) 0.0017
Further Details:      
 
Domain Number 8 Region: 805-875
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-19
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 9 Region: 980-1049
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-17
Family SH3-domain 0.0000719
Further Details:      
 
Domain Number 10 Region: 921-966
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018121   Gene: ENSGMOG00000016822   Transcript: ENSGMOT00000018568
Sequence length 1629
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2351:132679:208569:-1 gene:ENSGMOG00000016822 transcript:ENSGMOT00000018568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTTFAVLGPVSDVFMISLDERAKHDQQFHSLAPAGGYITVLGDQARNFFLQSGLPP
PILAQIWALADMNSDGRMDIYEFSIAMKLIKLKLQGHPLPSSLPPSMNLPLPPQTAFALL
LGVSPPLTSSAPPPLPPPISNGAPPTGIIQPIAVFPHPGSSVNKSSSFSRSSSKLQKGPS
VEAASALTPPPDWAVPQSSRLKYRQLFNSQDKMMSGHLTGPQARTILMQSSLPQTQLASI
WSLSDIDQDGKLTAEEFILAMHLIDMAMSGLPLPPILPPDYLPPTFRRVRSDSVQSDQKS
VQEEAEEEAETNQKLPVTFEDKKRENFERGNLELEKRRQALLELQRKEQERLATLEREEQ
ERKERERAAKRELERQRQLEWERQRRQELLTQRNREQESIVLLKARKKTLEFELEALNDK
KSQLEGKLQDVRFRLSAQRREVEQTNQTRETRIAEITLLQQQLQDSQQWLGRLIPDKQCL
NDQLKQVQQNSLHRDSLNSLQKAVDQKESSRQQLKDQLDSVEKETRSKLLEIDAFNTQLK
ELREIHCRQQRQKQKESEGYAHTQTHPFSHAHTQNEKRSAELQDIRCPSEEVGAWRGEGG
ALAPKVPSPGGTSASQAWLNRVKVPVTSFDQQPMKVVYYRALYPFDARSHDEISIAPGDI
VMVDESQTGEPGWLGGELRGRTGWFPANYAERIPDSEAPISLRSSASATPTPTRQPVATP
PPAPGQSSSASSVSSNWADFSTTWPSTTANQSDSEGWDAWPTSSTNQNPSLSVPSAQLRQ
RSAFTPATMTSGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNEVITVLEQQDM
WWLGELQSGQRGWFPKSYVKLISASMTAPPESGASESPPCGKHPSPSPTKLSDSGEGNTH
KIKHXXXXXXXXXXXXXXXXEQGDLSFQQGDVVLVTRKEGDWWTGVVSGKNGVFPSNYVK
PRDSSSESLGPAGKTGSLGKKPEIAQVIAPYSATGAEQLTLAPGQLILIRKKNPGGWWEG
ELQARGKKRQIGWFPANYVKLLSPSTSKTTPTEPLPPKLSLSLALCQVIGMYDYVAQNDD
ELAFLKGQVITVISKDDCDWWKGELNGREGLFPSNYVKLTTDTDPSTQWCADLHLLDMLS
PMERKRQGYTHELIVTEENYVNDLQLVTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
THTHTALRVRKKMSGDRMPVKMIGDILTNQLPHMQPYIRFCSCQLNGATLIQQKTDDNPE
VKDFLKRLAMDPRCKGMPLSSFLLKPMQRVTRYPLIIKNILENTPEPHPDHSHLKAALEK
AEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLFKA
KSSKELYGFLFNDFLLLTQVTKPLGFSASDKVFSSKTHLQYRMYKTPIFLNEVLVKLPTD
PSGDEPLFHISHIDRVYTLRAESINERTAWVQKIKAASELFIETEKKKREKAYLVRSQRA
TGIGRLMVNIVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTLQDTLNPKWNSNCQFFIK
DLEQDVLCVTVFERDQFSPDDFLGRTEIRLAEIKKDQGSKGPITKRLLLHEVPTGEIVVR
LDLQLFEEP
Download sequence
Identical sequences ENSGMOP00000018121 ENSGMOP00000018121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]