SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018129 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018129
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily EF-hand 7.65e-53
Family Calmodulin-like 0.000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018129   Gene: ENSGMOG00000016888   Transcript: ENSGMOT00000018576
Sequence length 192
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1079:50786:62286:1 gene:ENSGMOG00000016888 transcript:ENSGMOT00000018576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMGKTNSKLTPEVMEDLVKSTEFNEHELKQWYRGFLKDCPTGRLNLDEFQQLYVKFFPYG
DASKFAQHAFRTFDKNSDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRV
EMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDRIFSKMDKNNDDQISLDEFKEAAKSDP
SIVLLLQCDMQK
Download sequence
Identical sequences ENSGMOP00000018129 ENSGMOP00000018129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]