SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018181 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018181
Domain Number 1 Region: 119-302
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-25
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 413-523
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000249
Family Second domain of FERM 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018181
Domain Number - Region: 308-398
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0248
Family Ras-binding domain, RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018181   Gene: ENSGMOG00000016829   Transcript: ENSGMOT00000018628
Sequence length 631
Comment pep:novel genescaffold:gadMor1:GeneScaffold_802:16316:22768:-1 gene:ENSGMOG00000016829 transcript:ENSGMOT00000018628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNSKPCYTAGSPSFYCLQDMMRVCSETSAHFSSVTSRMLLALDNKWLAEQHTVPHAIPAL
FRPAPVERVKTTVSNPAYASGPERGPSEEEGLHMGYTALEVRSKMMSLEKADVCVLNPLY
GSDLQYTNRVDKVIINPYFGLGAPDYSKIQIPKREKWQHGPNSVSEDKERQWVDDFPLHR
SACEGDTELLTKLLDSGFSVKQLDSDHWAPIHYACWHGKVEATSLLLEKGKCNPNLLNGQ
LSSPLHFAARGGHSEIVKLLLQHSEIDRHIEDQQKRSPLQVCEENKQNEWEETVKLLQQA
STKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQESQQYFTIWICSENLNLQL
KPYHKPLQHLRIWTEIVTDLTVLDPQRENPQLFLRRDVRLPLDVEKKVEDPLSILILFDE
ARHSLLKGMFPSPDSKLITLASLLLQIIYGNYESKKHKQGFLNNSEENLRSIVPMSKVKS
KAYHWTNRILYEYKALSTSEGVSKEMHHLQRLFLQNCWDVPTYGAAFFTGQVYTKASASN
HKVIRVMVGVNTKGLHLMNMETKVLLISLEYGGFMWQLGQADLYFQIHSVENKMNIIVHT
KQAGLIVKLLMKLSGQMTPNDKSLSDKYAYG
Download sequence
Identical sequences ENSGMOP00000018181 ENSGMOP00000018181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]