SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018230 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018230
Domain Number 1 Region: 21-94
Classification Level Classification E-value
Superfamily EF-hand 6.3e-26
Family Calmodulin-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018230   Gene: ENSGMOG00000016979   Transcript: ENSGMOT00000018678
Sequence length 95
Comment pep:novel contig::contig436877:51:1144:-1 gene:ENSGMOG00000016979 transcript:ENSGMOT00000018678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGTVSPAPPRPRKKPAHKQPELTEEQKQEIREAFDLFDTDGTGTIDVKELKVAMRALGF
EPKKEEIKKMIADIDKQGSGMIDFNDFLSMMTPKM
Download sequence
Identical sequences ENSGMOP00000018230 ENSGMOP00000018230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]