SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018253 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018253
Domain Number 1 Region: 85-243
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.88e-59
Family Calpain large subunit, middle domain (domain III) 0.000000776
Further Details:      
 
Domain Number 2 Region: 257-428
Classification Level Classification E-value
Superfamily EF-hand 1.58e-39
Family Penta-EF-hand proteins 0.0000034
Further Details:      
 
Domain Number 3 Region: 3-79
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-26
Family Calpain large subunit, catalytic domain (domain II) 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018253   Gene: ENSGMOG00000016985   Transcript: ENSGMOT00000018701
Sequence length 430
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1037:251:6407:1 gene:ENSGMOG00000016985 transcript:ENSGMOT00000018701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDYRGRMERLIRVRNPWGQVEWTGAWSDSSPEWDEIDPSEREDLHCQMEDGEFWMSFNEF
LRQFSRLEICNLTADALSDEGLSHWNTIKFHGSWRRGSSAGGCRNCPNTFWINPQYKITL
LEEDDDPEDDEVACSFLVALMQKDRRRHRRQGQDMHTIGFAIYEIPEEFKGCQNVHLKKQ
FFLTKSSCARSETFINLREVSTRLRLPPGEYLIVPSTFEANQEADFVLRVFTEKQSETEE
LDDVISADLDDESDISEDDIDDSFKSMFAQLAGEDMEISVHELRTILNRVVSRHQDLQTD
GFSLVSCRTMVNLMDKDGSARLGMVEFQILWNKIRKWLLIFRQFDLDKSGAMNSYEMRMA
VEAAGFTLNNKLNTVLVARYADNDMIDFDNFICCLVKLEAMFRSFQELNKNDEGVAEMQL
TEWLYLTMCG
Download sequence
Identical sequences ENSGMOP00000018253 ENSGMOP00000018253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]