SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018295 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018295
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-55
Family DBL homology domain (DH-domain) 0.0000248
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-32
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 383-490
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-28
Family DEP domain 0.0044
Further Details:      
 
Domain Number 4 Region: 475-605
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-28
Family DEP domain 0.0012
Further Details:      
 
Domain Number 5 Region: 675-741
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000841
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 575-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000021
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018295   Gene: ENSGMOG00000016980   Transcript: ENSGMOT00000018742
Sequence length 1613
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2460:196174:321734:-1 gene:ENSGMOG00000016980 transcript:ENSGMOT00000018742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEENKSEHRAESGKDLEKQLRLRVCVLNELLQTERDYVGTLEFLSVFMHRLHQYAAAKI
DKNITEETVKVLFSNTEEILAVHRDFLSMVEGLLQPDPHAHHEVGRCFLQFRSGFQVYDE
YCGNHEKAQRLLLELNKIRSVRTCLLNCMLLGGRKNTEVPLEGYLVAPIQRICKYPLLLR
ELLKRTPKKHNDHGLVLEALQVMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITD
TCTEMLMHGVLLKISAGNIQERNFFLFDKLLVYCKKKNRRLKNSKAATECPRFLFRGRIN
TEVMEVENVDDGTADYHSSGNIVNSGWKIHNTAKNKWFVCMAKTPEEKQEWLEAILKERE
RRKSLRLGMEQDTWVMVSEKGEKLYQLMTKGHLIKDRKRKLSTFPKCFLGSEFVSWLMDI
GETGNPEEGVHLGQALLENGIIHHVTDKHQFKPEPVLYRFRYDDGTYHPRSDMQDVISKG
VRLFCRLHSLFSPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEALILGVELCDN
GFMHHVLEKSEFKDEPLLFRFFADEEMEGSNTKHKPMKHDLKIAENVIAKALLIRPSDGG
YGFTLEERNRVPIIKAVEKGSPAEMAGLEVGKKLFAMNGDLVFLRPFSEVESLLRQCFES
KGPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAVAGLHPGQCIIKV
NGINVSKESHASVIAHVTACRKYRRPTQQDTIKWVYNNNESAQEDERKSNQKRSAEENED
GFECKVEEVMDKFNTIAIIDGKKELVSLTVDNVHLEYGVVYDYDSTAGIKCHVLEKMVEP
KGFFNLTAKILEALARNDDTLVQMCGRLSSSCDVIPEELRSRLAALCGERLEHVNRRLTN
YRKFARVLRNRAWPTFKQAKTKVSPLHSSDFCPTNCHVNVMEVSYPKTTTSLGSAFGVQL
DSRRNTMEGGGRSSAEHGKVSPMVYAQHTITTMAAPSGHSLGRTEGHGLRFLLREEDLQT
LDAYQKLVAKLTTVVKEMDTHAAQIHDLLSSISHPGATDAKTPEGLIAPESEAERGEKNG
KKVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSHCSSYVHSDEMDSGD
EMPSSMWLSHDKQKKLHGFLEHLFSQVDSITSMLRGALVGRAFEQTKCFTPGRGLQEFQQ
EMEPRLNCTKKLRLHVKQDPWNLPGSVHAFTHTVGRFVEEVKTRLLLVLLQYTDSEIQLR
RDMVFCQSLVAAVCAFSQHLLAVLNQFHDGGRDCEPESQDSTDPPEPQEGGRRWLEQVAS
AGLLLHFQSLLSPHLTDEQAMLEDTQVALIDLEKVTFYFRQFEGEPLVANMPVSYQVEGT
RQALKVCFYLEGFYFSQLPQRLRNGGGFRIYPVLFTQALESMEGYYYRDNVSVEEYQAQI
NAASLDKVKQYYKRLRAFYLDQSNMPPSSAPKAALVDKLMRPLNALDELYRLIESFISCR
RTAACQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTLSVTLEQAILLARNHG
LPPRCIMQATDVMRKQGARVQNSAKNLGVRDRTPSTVPRLYKLCQPPPRTATH
Download sequence
Identical sequences ENSGMOP00000018295 ENSGMOP00000018295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]