SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018406 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018406
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.96e-71
Family A middle domain of Talin 1 0.000000355
Further Details:      
 
Domain Number 2 Region: 756-892
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.94e-52
Family I/LWEQ domain 0.00000181
Further Details:      
 
Domain Number 3 Region: 661-786
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.83e-47
Family I/LWEQ domain 0.0000045
Further Details:      
 
Domain Number 4 Region: 1841-1975
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.39e-44
Family VBS domain 0.00000982
Further Details:      
 
Domain Number 5 Region: 1228-1364
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.02e-40
Family VBS domain 0.024
Further Details:      
 
Domain Number 6 Region: 2297-2487
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.37e-33
Family I/LWEQ domain 0.00054
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.23e-29
Family Second domain of FERM 0.00000184
Further Details:      
 
Domain Number 8 Region: 1078-1210
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.63e-26
Family VBS domain 0.017
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.33e-23
Family Third domain of FERM 0.0000228
Further Details:      
 
Domain Number 10 Region: 1471-1558
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000314
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 1697-1817
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000267
Family VBS domain 0.07
Further Details:      
 
Domain Number 12 Region: 81-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000121
Family Ubiquitin-related 0.066
Further Details:      
 
Domain Number 13 Region: 2007-2134
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000596
Family VBS domain 0.035
Further Details:      
 
Domain Number 14 Region: 1596-1662
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000722
Family VBS domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018406
Domain Number - Region: 2137-2292
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00255
Family I/LWEQ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018406   Gene: ENSGMOG00000017059   Transcript: ENSGMOT00000018858
Sequence length 2543
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3816:245563:328444:1 gene:ENSGMOG00000017059 transcript:ENSGMOT00000018858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSLKICVRQCNVVKTMQFEPCTAVYDACRIIRERVAEAQAGQASDYGLFLSDEDPRK
GIWLESGRTMDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLTQEGVEEKKEEHTGTLKKDRTLLRDEKKMEKLKAKLHTDDELNWLDHSR
TFREQGVEEVETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACLF
AGIQAQIQFGPYIEHKHKPGFLDLKEFLPKEYIKQKGAEKKVFQDHSSCGDMTEIETKVK
YVKLARSLRTYGVTFFLVKEKMKSKNKLVPRLLGITKESVLRVDERTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGVIRSGSVGAESLSTGTMPSAQQQITM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQQAQIDLGEVDNLPPLGQDMASKVWIQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MEDDTSGGNHLMGAARTLAGAVSDLLKAVEPASGEPRQTVLTAAGSIGQASGDLLRHIGE
NETDERFQDILMSLAKAVANAAAMLVLKAKNVAQVADDTVLQNRVIAAATQCALSTSQLV
ACAKVVVSPTISSPVCQEQLIEAGKLVDRSVEGCVQACLSATEDGELLKQVSAAASVVSQ
ALGELLQHVRQYTSRGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDL
VNAMRSDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEG
LRVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAASQNAAASNKNTSAHQQLVQSCK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSKMVTSSKSSVPTVTDQAAA
MQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTSIQNLKSELQDAQLAAVAGQLK
PLPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHYTGIAASETAQALKTLAQAARG
VAAATTDPAAAVAMLESAGDVMEGSALLIHEAKQALECPGDAESQQRLAQVAKAVSHSLN
SCVNCLPGQKDVDLALRSIGEASKKLLVDNVPLSSKSFQEAQSELTHTAAELNQSAGDVV
HASRSSSRQLAAASGKFSHDFDDFLDAGIEMAGHTPKKDDQIQVIGNLKNISMASSKLLL
AAKSLSVDPAAANAKNLLSAAARAVTESINQLITLCTQQAPGQKECDNALRELEAVRGLL
DSPNEPVSDLSYFHCIESVMENSKVLGESMAGISQNCKLGDVGAFGDCVGSASKALCGLT
EAAGQAAYLVGVSDPNSQAGHQGLVDPIQFAKANQAIHMACQNLVDPDSNPSQVLSAATI
VAKHTSALCNACRLASSKTSNPAAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRNK
CGVATAPLIEAVENLTAFASNPEFATVPAKISRQGCAAQEPIILSARSMLDSSTHLLKTA
RSLVINPKDPPTWSVLAGHSRTVSDSIKALITAIRDKAPGQRECDSSIDNINQCIRDIEQ
ASLAAVSQNLPCRDDISLEALQDQLTSSVQEIGHLIDPVSTAARGEAAQLGHKVAQLAGY
FEPLIVASVGVASRLRDHQQQMTFLDQTKTLAESTLQMLYAAKEGGGNPKASHTHEAIAE
AAQLMREAVDDIMITLNDAASEGGMVGGMVDSIAEAMSKLDEGTPPGLEGCFVDYQTNMV
RHSKAIAVTAQEMMTRSVTCPEELGGLASQVTVDYGQLAVQGRLAAHTAEPEEIGFQIKT
RVQDLGHGCIFLVQKAGALQGMPSDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQAC
ITAGSAVSGIIADLDTTIMFASAGTLNAEDNESFADHRESILKTAKALVEDTKMLVSGAA
SGQDRLAQAAQSSAKTITLLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALGELISAT
KCAAGKAADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELT
VFQSREPPANSTTPEEFIRMTKGITNATAKAVAAGNSGQQEDIISTANLSRKAITDMLTT
CKKAAFHSEVSEEVRSRALMFGTECTTGYIDLLEHVLQVLQKPTPEQKQQLAVCSKRVAG
AVTELIQTAEAMKGAEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADES
LDFEEQILEAAKSIAAATSALVKSASAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAR
LVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQA
AGNAVKRASDNLVRAAQKAAFDKADDDNVVVKTKFVGGIAQIIAAQEEMLRKERELEEAR
KKLAQIRQQQYKFLPTELREDSN
Download sequence
Identical sequences ENSGMOP00000018406 ENSGMOP00000018406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]