SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018422 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018422
Domain Number 1 Region: 158-310
Classification Level Classification E-value
Superfamily EF-hand 1.42e-28
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 2 Region: 45-180
Classification Level Classification E-value
Superfamily EF-hand 1.28e-18
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018422   Gene: ENSGMOG00000017144   Transcript: ENSGMOT00000018874
Sequence length 317
Comment pep:novel genescaffold:gadMor1:GeneScaffold_70:74:24516:1 gene:ENSGMOG00000017144 transcript:ENSGMOT00000018874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMLLRLLVSSFLLAGTSFAVPTKEKRVHRHGDLSDHPHKDATDFQYDHEAFLGKEDAKTF
DQLTPEESKERLAKIIGRIDINKDGFVNHSELHYWIKHRQRRYIEENVNKHWREYDVNQD
DKISWEEYKNTTYGYYHGEEFDDVEEKDTYKAMLTRDQRRFKEADRDHDGIATREEFTAF
LHPEEFDHMRGLVVQETMDDIDKNGDGKVDIDEYIGDMFTPENGEKEPDWVLTERQHFHQ
IRDENKNGYLEAAEVAQWVLPTEVDHADNEAKHLIHETDTNKDEKMSKEEILVNWNMFVG
SQATNYGEDLTKRHDEL
Download sequence
Identical sequences ENSGMOP00000018422 ENSGMOP00000018422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]