SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018542 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018542
Domain Number 1 Region: 17-489
Classification Level Classification E-value
Superfamily Sema domain 9.29e-183
Family Sema domain 0.00000000000584
Further Details:      
 
Domain Number 2 Region: 485-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000436
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 549-632
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000633
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018542   Gene: ENSGMOG00000017239   Transcript: ENSGMOT00000018997
Sequence length 725
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2602:49247:63359:1 gene:ENSGMOG00000017239 transcript:ENSGMOT00000018997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLICVYLSELQQFHGVRRYELDRSCCFGALLLDEERGRLFVGAKNFLISLSLENIGKQEH
KIYWPAPVNWREECNWAGKEINVDCVNYVKILHHYNRTHLFACGTGAFHPTCAFVEVGQK
FEDGVFRIDPTKVEDGKGRSPYDPRHTAASVLIGDELYAGVATDLMGRDFTIFRSLGKAI
RTEQHDSRWLNEPKFVGSFWVPESENPDDDKIFFFFRETAVEAQGLGKSSYSRIGQLCRN
DMGGQRSLVNKWTTFLKTRLICSVPGADGSDTYFDELRDVFLLQTRDRKNPLVYTVFSTS
SSVFKGSAVCIYTMNDIRRAFLGPFAHKEGPNYQWVPFQGKVPYPRPGMCPSKTFGSFDS
TKGFPDDVIQFARHHPLMFNPVYPLNRRPVFLRTNVEYSFTQVAVDRVNAADGQYDVMFI
GTDKGTVLKVISVPKERWNNMEDLLLEELEVFKDASSIINMQISSKRQQLYVGSDTGIAQ
VPLHRCSVYGKACTECCLARDPYCAWDGTSCTRYLPNTKRRFRRQDVRNGDPNTLCSGDH
HKHRVIERKLYGVESSSTFLECIPKSLQARVTWTFQKNPQQTREEVRLDDRVLQTDRGLL
IRRVLKKDVGVYQCHAMEHGFTQTLLGITLEVVPSSSSSTSISNLPSDSPVRLEPRSGGG
PSSTNQKLWYRDFMQLAAVKQAPPVAPVNRPPNKKWKHLQDIRKGRNRRTHDGKQNPRAP
RSAGE
Download sequence
Identical sequences ENSGMOP00000018542 ENSGMOP00000018542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]